ClimaUno VRF
ClimaUno VRF
(57(5 50 Hz
Introduction
&OLPD8QRZDVIRXQGHGLQ,WDO\DUHVXOWRIVWUDWHJLFFRRSHUDWLRQEHWZHHQZLGHH[SHULHQFHGPDUNHWLQJSURIHVVLRQDOVZKR
KDYHGHGLFDWHGLQWKHILHOGRIDLUFRQGLWLRQLQJIRURYHU\HDUV
'XULQJWKHSDVW\HDU&OLPD8QRKDVGLVWLQJXLVKHGLWVHOIIRUFRQVFLRXVFXVWRPHUFDUHDQGH[FHOOHQFHLQDIWHUVDOHVVHUYLFHV
E\SURPRWLQJVHOOLQJDQGVHUYLFLQJDZLGHUDQJHRILQQRYDWLYHSURGXFWVVXLWDEOHIRUVSHFLILFPDUNHWVHJPHQWVOLNHUHVLGHQWLDO
DQGFRPPHUFLDOEXLOGLQJVFLQHPDVVSRUWFRPSOH[HVWUDGLQJFHQWHUVKRVSLWDOVIRRGLQGXVWULHVVKRSSLQJPDOOV
&OLPD8QRLVSUHVHQWLQ(XURSH0LGGOH(DVWDQG1RUWK$IULFD$OOSURGXFWVDUHRIIHUHGIRUPHGLXPWRKLJKDPELHQWFOLPDWHV
XSWR&XVLQJHFRIULHQGO\UHIULJHUDQWVDQG(XURSHDQFHUWLILHGWHFKQRORJ\ERWKIRUDQG+]
7KHGLVWULEXWLRQQHWZRUNDFFRXQWVIRURYHUSHRSOHDOOGHGLFDWHGWRFXVWRPHUFDUHDQGVDWLVIDFWLRQSURYLGLQJKLJKTXDOLW\
SURGXFWVDWDFRQYHQLHQWSULFHSDFNDJH
0LVVLRQ
)RURYHUWKHSDVW\HDUVRIDFWLYLW\&OLPD8QRKDVGHILQHGWKH,QWHUQDWLRQDORIIHUWRFRPIRUWHVWDEOLVKLQJWKHLQGLYLGXDOZHOOEHLQJ
DQGVDWLVIDFWLRQDVWKHRQHPLVVLRQWRZKLFKDOOLWVVWDIIDQGSHUVRQQHODUHGHGLFDWHGZLWKWKHEHVWRIWKHLUNQRZOHGJH
&OLPD8QRPHDQVFXVWRPHUVFDUH VDWLVIDFWLRQ
&59&OLPD8QR5HIULJHUDQW9DULDEOH6\VWHP
&OLPD8QR'&,QYHUWHU95)V\VWHP:LWKZLGHFKRLFHRIRXWGRRUDQGLQGRRUXQLWFDQSURYLGHVXLWDEOH95)V\VWHPIRUGLIIHUHQW
DSSOLFDWLRQDUHDWRJLYH\RXDVHWRILQWHJUDWHGDLUFRQGLWLRQVROXWLRQDQGDQVZHUHGWKHQHHGVRIEXLOGLQJVL]HDQGLQWHULRUGHVLJQ
'XHWR+LJK7HFKQRORJ\'&,QYHUWHU&RPSUHVVRUV+LJK(IILHQF\LVDFKHLYHGDQGHQHUJ\VDYLQJFDQEHUHDOL]HG
0
Energy Saving
Hydrophilic
Dc lnverter
180Sine Wave Control Sleep Mode Aluminum Fin
With considerable advantages, DC Users can select sleep mode after The louvered hydrophilic aluminum
Inverter 180 sine wave driving pressing time-off button. This foil has improved by more than 10
technology has much wider range of function will adjust temperature % The refrigerant inlet and outlet
frequency and voltage, higher automatically, which makes a are separated, to ensure the sub-
energy efficiency, more smooth comfortable sleep environment. cooling, enhance the cooling
running and lower noise. capacity.
Comfort
Independent
Dehumidification 3D Air Flow Fast Cooling/Heating Auto Swing
With the independent dehumidificati- Combine vertical and horizontal auto Startup at high frequency increases Distributes cool/warm air to maxim-
on function, the unit can efficiently swing to ensure an even distribution cooling/heating capacity and reduces um area by moving horizontal and
dehumidify the room and give you of air flow throughout the room. time to reach set temperature, thus vertical flags automatically.
more comfort. you can enjoy cooling and heating in
seconds.
When starting the heating operation, Atemperature sensor is built in the Outdoor unit records the highest
the fan speed is regulated automaticl- remote control, it will sense its surro- temperature with sensor and 7 hours
ly from the lowest speed to the preset unding temperature, so the unit can later after, it automatically runs in
level. This function can prevent cold achieve accurate and comfortable silent mode and lower the noise
air from blowing out at the beginning temperature control just like the air level.
of the operation, which avoids the conditioner is following you.
discomfort to the user.
0
Health
Air outside can be led into the room The latest long-term filter ensures When this function is activated,ind-
via a connection pipe, which keeps better air quality. Meanwhile, the oor unit will running with special
the indoor air fresh and healthy. cleaning frequency has been combined mode to blow and dry
decreased, and maintenance is also indoor evaporator so as to keep
much easier. clean and healthy.
Reliability
EC
Compressor
Self-diagnosis Function Low Ambient Cooling Intelligent Defrosting Heating Belt
Once abnormal operation or parts With special designed PCB, outdoor Normal defrost functioncan only Auxiliary heating belt can increase
failure happen, the unit will monito- fan speed can be changed automati- EHoperated in certain time, but compressor oil temperature in
ring the failures, the microcomputer cally according to condensation &OLPD8QRcommercial air winter and prevent defrosting water
of air conditioner will switch off temperature. The air conditioner can FRQGLWLRQHU
Vi n t e l l i g e n t d e f r o s t accumulated, which improves heat
and protect the system automatically run cooling operation even when the FDQVWDUWautomatically according transfer efficiency.
when it happens. Meanwhile, the outdoor ambient temperature down WKHWRsurrounding condition.
error or protection code will be to -15.
displayed on the indoor unit.
Built-in auxiliary electric heater as Effectively prevent bacteria breeding Electrical control box adopts new
option, the heating performance will and improve heat transfer efficiency. design, which can meet the higher
be more powerful. The unique anti-corrosive golden fire safety requirement to prevent
coating on the condenser can the internal fire due to the electric
withstand the rain, salty air and other spark accident.
corrosive elements.
0
Convenience
26 cECO
24-hour Timer Built-in Drain Pump Dual Side Drainage Digital Tube Display
Users can turn on or turn off the air The built-in pump can lift theconde- Both left and right sides of the Easily for the running parameters
conditioner at any time in 24 hours nsing water up to 1200mm upmost indoor unit are possible for drainage checking and more convenient for
with remote controller or wireless from the drainage pan. hose connection, and it's easy for troubleshooting, digital tube
controller. installation with this function. displays work status such as indoor
temperature, setting temperature, the
mode of operation, etc.
MCGS
Help users to control the air conditi- Help users to control the air condit- With the control function of weekly &OLPD8QRAC equipped with WIFI
oner easily, you can design your oner easily, the wired controller can timer, zone( or group) setting etc., Control technology, when connectiQJ
most comfortable settings with this be fixed on the wall and avoid misl- the centralized controller can to intelligent terminal, customersFDQ
controller. aying. It's mainly used for commerc- control 64 units with the RS485 enjoy fun and convenience of UHPRWH
ial zone and makes air conditioner wire connection units and adapter control via mobile phones, LSDGDQG
control more convenient. plate. other mobile terminals $QGURLGDQG
,26to control the $&DWDQ\WLPH
DQG anywhere.
The indoor unit filter can be taken If the air conditioner breaks off
off to wash easily and it keeps clea- unexpectedly due to the power cut,
ning air all the time. it will restart with the previous setti-
ng mode automatically when the
power resume.
0
Indoor Unit:
CRV CA - H 028 / 4 R1 A
h Refrigerant Variable AC
Outdoor Unit:
CRV - H 028 / 5 R1 M A
)RV III
ARV III
driving technology, dual compressors parallel technology, patented energy-saving operation technology and improved performance of
heat exchanger. 100
%
6.17
6.2
80
6.08
6.1
6.03
60
Load capacity
6.0
5.9
5.9 5.85 40
5.81
5.8
20
5.7
0
5.6
8HP 10HP 12HP 14HP 16HP 18HP 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21
T h
Because the outdoor ambient temperature and indoor load is different at different times of day, most of time, the system works
under part load. So it is better to assess the energy saving performance using IPLV.
IPLV(C)=0.05EER(100%)+0.3EER(75%)+0.4EER(50%)+0.25EER(25%).
The high pressure chamber compressor can make the oil circuiting with Intrinsic pressure difference, and ensure sufficient oil supply
when running at low frequency. The suction gas of low pressure chamber compressor will be heated when going through the scroll.
However, the suction gas of the high pressure chamber compressor directly back to the scroll, which makes the superheat of
refrigerant gas smaller and a high volume efficiency.
The motor of the low pressure chamber compressor is cooled by the suction refrigerant, which causes poor lubrication because of
the instability of the oil temperature under the low ambient temperature operation. However, the motor of the high pressure
chamber compressor is cooled by the discharge gas, and the unit can get a better heating performance.
The whole high pressure chamber of the high pressure chamber compressor can work as a composite muffler , so it can reduce the
discharge noise.
0
3. Sub-cooling technology
Prevent heat exchange between outlet and inlet17.6 sub-cooling.Enhance degree of sub cooling.
Enhance cooling capacity.Reduce the pressure resistance.
Ensure longer pipe length.
2 to 1refringerant circuit
Gas
refrigerant Liquid refrigerant
2. Silence Operation
Outdoor unit quiet mode
By using optimized fan blades and the CFD(Computational Fluid Dynamics) technology, the product is equipped with the
night low-noise operation function. Provide more quiet operation during the night. Minimum operation noise only 45
dB(A).
Night silent operation ( Compare with normal operation, silent operation noise reduce 12dB(A).
ARV III
Super mute unit silent running Super mute unit bare machine running silent mode at night
0 20 dB(A)
3. Humanization Design
Special design economic locking function, through outdoor PCB switch setting. If work in
economic lock, AC lowest work cooling temperature will keep in 26 and highest heating
temperature keep 20. 26
Save energy and keep provide comfortable.
6. Intelligent defrosting
intelligent defrosting technique extends the heating operation and decrease the frequency of defrosting. Result in stable
room temperature, offer comfort life.
Temp
24
20 Comfortable
18
Normal defrosting Cold
10
Defrosting Heating Operation Defrosting Heating Operation Defrosting Heating Operation Time
Temp
24
20 Comfortable
Comfort
f able
18
Conventional
Cold
intelligent defrosting
10
Defrost
Defros
D efrost
efros
s iing
Defrosting g Heating Operation Defrost
Defro
D efros
efro
o ing
g
Defrosting Heating Operation Defros
Defrost
Defr
Defro
D efr
efro
fr
f ing
g
Defrosting Heating Operation Time
e
Temp
24
20 Comfortable
18
intelligent Cold
Co
Co
defrosting
10
Defrosting Heating
in
n Operation Defrosting Heating Operation Defrost
f
fr ing
Defrosting Heating Operation
Operat
erat
e rrattion
io
io
on Time
ARV III
52 -20
3. Changeable ESP
Optimized fan provide outdoor unit up to 82Pa static pressure. Outdoor units can be installed in the service floor or facility
room.
0 pa 20 pa 20-82 pa
15m
4. Non-polar Communication
No polar in communication wire ,easy installation and commissioning.
5. Auto Addressing
The outdoor units distribute indoor system address automatically. No need manually setting. More convenient and saving the installation
time.
15m 90m
ARV III
90m
Max. Total piping length 1000m
Max. Actual piping length 175m
Max. Level dierence between indoor units 15m
Max. Level dierence between ODU and IDU units 90m
Max. Level dierence between ODU and ODU units 5m
Max. piping length from 1st indoor Branch to the farthest indoor unit 40m
T
Normal start-up sequence:1--2.
Emergency back-up start-up sequence:1--3.
More Combination
8/10/12HP 14/16/18HP 20/22/24/26/28/30/32HP 34/36/38/40/42/44/46/48HP
50/52/54/56/58/60/62/64/66/68/70/72HP
ARV III
ARV III
Cooling kW 25.2 28.0 33.5 40.0 45.0 50.4
Capacity
Heating kW 28.0 31.5 37.5 45.0 50.0 55.5
Power Supply V~,Hz,Ph 380~415,50,3 380~415,50,3 380~415,50,3 380~415,50,3 380~415,50,3 380~415,50,3
Cooling Power Input kW 5.8 7.1 8.9 11.3 12.9 14.3
Electric Data Heating Power Input kW 6.1 7.6 9.1 11.2 12.8 15.0
Cooling Current A 8.8 10.8 13.5 18.7 21.1 23.3
Heating Current A 9.3 11.5 13.8 16.9 19.5 22.8
Air Flow Volume m /h
3
12000 12000 12000 72502 75002 75002
Performance
Noise Level dB(A) 45-58 45-58 45-58 47-61 47-61 47-61
Vertical Pipe Length m 90 90 90 90 90 90
Actual Pipe Length m 165 165 165 165 165 165
Piping Limite
Equivalent Pipe Length m 190 190 190 190 190 190
Total Pipe length m 1000 1000 1000 1000 1000 1000
Max. No. of Indoor Units unit 13 16 19 23 26 30
Connection Ratio % 50~130 50~130 50~130 50~130 50~130 50~130
Net mm 930x765x1680 930x765x1680 930x765x1680 13407651680 13407651680 13407651680
Dimension(WxDxH)
Packing mm 9808101850 9808101850 9808101850 14008101850 14008101850 14008101850
Net kg 223 223 248 303 303 318
Weight
Gross kg 243 243 268 325 325 340
Refrigerant Type R410a R410a R410a R410a R410a R410a
Liquid Side mm(inch) 12.7(1/2) 12.7(1/2) 12.7(1/2) 12.7(1/2) 12.7(1/2) 12.7(1/2)
Pipe Diameter
Gas Side mm(inch) 22.2(7/8) 22.2(7/8) 22.2(7/8) 28.6(9/8) 28.6(9/8) 28.6(9/8)
Cooling -15~52 -15~52 -15~52 -15~52 -15~52 -15~52
Operation Range
Heating -20~24 -20~24 -20~24 -20~24 -20~24 -20~24
Stuffing Quantity 20/40/40H unit 14/28/28 14/28/28 14/28/28 11/22/22 11/22/22 11/22/22
Notes
1.Cooling Capacity: Indoor temperature 27 DB/19 WB;Outdoor temperature:35 DB/24 WB.
2.Heating Capacity:Indoor temperature 20 DB;Outdoor temperature:7 DB/6 WB.
3.Piping Length:Equivalent piping length:7.5m,level differernce:0m.
4.Anechoic chamber conversion value,measured in test room.During actual operation.These values are normally somewhat higher as a result
of ambient conditons.
5.The above designs and specifications are subject to change of product improvement without prior notice.
Standard Optional
Indoor Units - CA
1. Ultra Slim Design 2. 5-segment Heat Exchanger
Only 250mm in height, save installation space. Innovative exchanger design enlarges the heat
exchanging area and increase the heat exchanging
efficiency by 10% to 15%.
250mm
470mm
1200mm
Four-way Cassette Indoor Units
ts
AUTO
MODE
POWER
Standard Optional
Indoor Units - CF
3. Optional Noble Belt 4. Long Term Filter
Noble belts supply luxury appearance. The long-term air filter ensures better air quality and
decreases the cleaning frequency.
AUTO
MODE
POWER
Standard Optional
Indoor Units - SD
derrick
700mm
The ceiling
3. Silence Operation
Innovative centrifugal fan for large diameter and a new design of the spiral duct system equipped with high-quality motor at the same
time, making the air supply more quietly and smoothly. The lowest noise is 18 db(A).
16 18 30 40
bd(A) bd(A) bd(A) bd(A)
The lowest operation noise is 18 db(A)the industry's most advanced mute value.
Notes
1.Cooling Capacity: Indoor temperature 27 DB/19 WB;Outdoor temperature:35 DB/24 WB.
2.Heating Capacity:Indoor temperature 20 DB;Outdoor temperature:7 DB/6 WB.
3.Piping Length:Equivalent piping length:7.5m,level differernce:0m.
4.Sound level is measured at 1.4m below the air outlet.
5.The above designs and specifications are subject to change of product improvement without prior notice.
Standard Optional
Notes
1.Cooling Capacity: Indoor temperature 27 DB/19WB;Outdoor temperature:35 DB/24WB.
2.Heating Capacity:Indoor temperature 20 DB;Outdoor temperature:7 DB/6WB.
3.Piping Length:Equivalent piping length:7.5m,level differernce:0m.
4.Sound level is measured at 1.4m below the air outlet.
5.The above designs and specifications are subject to change of product improvement without prior notice.
Standard Optional
Indoor Units - MD
290mm
5. Standard Accessories
Return air box and air filter are standard for all models.
Indoor Units - MD
6. Optional ESP
50Pa and 80Pa can be freely chosen.
Indoor Units - MD
Specification-Mid ESP Duct IDU 50Hz
Standard Optional
Indoor Units - HD
indoo unit, so the air flow can be
set separately from the indoor
equally distributed even the room is in irregular structure.
Standard Optional
Indoor Units - FA
Notes
1.Cooling Capacity: Indoor temperature 27DB/19 WB;Outdoor temperature:35DB/24 WB.
2.Heating Capacity:Indoor temperature 20 DB;Outdoor temperature:7DB/6 WB.
3.Piping Length:Equivalent piping length:7.5m,level differernce:0m.
4.Sound level is measured at 1.4m below the air outlet.
5.The above designs and specifications are subject to change of product improvement without prior notice.
Indoor Units - FA
Connection Conditions
The following restrictions must be observed in order to maintain the indoor units connected to the same system.
When outdoor-air processing units are connected,the total connection capacity must be within 50% to 100% of that of the outdoor units.
When outdoor-air processing units are standard indoor unigs are connected,the total connection capacity of the outdoor-processing units must not exceed
30% of that of the outdoor units.
Outdoor-air processing units can be used without indoor units.
Wall-mounted IDU
LH LI
Standard Optional
Indoor Units - WM
Notes
1.Cooling Capacity: Indoor temperature 27 DB/19 WB;Outdoor temperature:35 DB/24 WB.
2.Heating Capacity:Indoor temperature 20 DB;Outdoor temperature:7 DB/6WB.
3.Piping Length:Equivalent piping length:7.5m,level differernce:0m.
4.Sound level is measured 1m below the air outlet horizontally and vertically.
5.The above designs and specifications are subject to change of product improvement without prior notice.
Wall-mounted Indoor Units
Notes
1.Cooling Capacity: Indoor temperature 27DB/19WB;Outdoor temperature:35DB/24WB.
2.Heating Capacity:Indoor temperature 20DB;Outdoor temperature:7DB/6WB.
3.Piping Length:Equivalent piping length:7.5m,level differernce:0m.
4.Sound level is measured 1m below the air outlet horizontally and vertically.
5.The above designs and specifications are subject to change of product improvement without prior notice.
Control Syetem
Central control
software
1 computer can access at most 64
Bacnet BMS Bacnet Gate
Gateway
a
ARV outdoor systems, max. control
4096 indoor units.
Communications
adapter plate
Touch screen central controller Central controller
1 touch screen central controller 1 central controller can control max. 4 Wired controller Wired controller Remote controller
can control at most 512 indoor units VRF systemat most 64 indoor units
Communications
adapter plate
1 wired controller can control max. 16
indoor units in one group
Wired controller
Control Syetem
Central control
software
1 computer can access at most 64
)RV outdoor systems, max. control
4096 indoor units.
Communications
adapter plate
Wired controller Wired controller Remote controller
Controllers
Remote controller
Signal transmitter Signal transmitter
3 10 SILENCE SLEEP 11
12 TIMER iFEEL 13
YK-L
1 ON/OFF 6 Vertical Swing/Horizontal Swing 11 Sleep Function 16 Clean Function
Temperature Setting
3 8 Turbo Wind 13 I Feel Function 18 Spot Swing
/Timer Range Setting
With the controller off, pressing / simultaneously more than 10 seconds or more to enter address settting. This status displays only temperature and
time parameters, temperature display area shows Serial number" parameters, the range is 0-99. Time display area shows "Set value", the range is 0-255. The initial
value is 1.
By pressing / to set serial number + and -.Parameters within the serial number displays from 0 to 99 in circulation.
By pressing ECO and iCLEAN to set value number + and -.Parameters within the value number displays from 0 to 255 in circulation. After setting the two numbers,
press the MODE button to confirm sending to ODU.
Controllers
Remote Controller
8
3 Vertical Swing 10 Timer On/Off
1 9
2 10
4 Feeling Function 11 Horizontal Swing
3 11
4 12
5 Strong Wind 12 Clean Function
5 13
YK-K
Wired Controller
Control Syetem
AUTO
AUT
AUTO
XK-02A XK-05A
Centralized Controller
Communications
adapter plate
Touch screen central controller Wired controller Wired controller Remote controller
Communications
adapter plate
Control Syetem
Communications
adapter plate
Function
1). Operation status of as many as 512 indoor units can be monitored in touch screen central controller, including wind speed, set temperature, etc.
Operation status of as many as 64 indoor units can be monitored in central controller, including wind speed, set temperature, etc.
2). Mode, air speed and temperature setting are possible for individual/zoned/all indoor units.
3). 3 operation modes are available: Last-in Preferred, Centralized Control and Lock;
4). The malfunctions of the indoor units can be monitored and saved for inquiry;
5). Timed on/off is possible by specifying the exact time or by weekly schedule.
6). Any number of centralized units can be zoned with as many as 63 indoor units (central controller) & 511 indoor units (touch screen central
controller) set as one zone, so that units in the same zone will carry out the same operation. (As the factory default, a centralized group is
considered as a zone)
Centralized Controller Software
1.System overview
(USB-485 Converter)
Centralized Control
Software Adapter 1
(Group Control)
(Wired Controller)
MAX.16
(Wired Controller)
Centralized Control
Software Adapter 2
(Group Control)
MAX.16
Control Syetem
(Wired Controller)
(Wired Controller)
2.Features:
Users do not need to arrive the harsh environment of the site, they can monitor the function of units just through computer. These
greatly improve convenience of daily management and the efficiency of central air conditioners;
Timely find the fault and save the maintenance cost of air conditioner units, minimize losses ;
Timer function with multi-period week, fully automated schedule planning of unit;
Each ARV unit can access at most 63 indoor sets;
This system can access at most 64 ARV outdoor systems, it need to access repeater to increase RS485 network equipment if the outdoor
systems are more than 64.
3.Main components of Centralized Controller System
No. Main components Required
Operation system:
1 Host computer
Windows XP SP2 and above, Windows 7
o RS-485/422
RS-232 to RS 485/422 converter
con
The centralized control system RS485 network signal conversion for RS232 serial
signal to achieve the interconnection of computers with centralized control system.
3
USB to RS-485/422 converter
The centralized control system RS485 network signal conversion for USB
to achieve the interconnection of laptops with centralized control system.
RS-485/422 Repeater Extend the communication distance and increase the number of RS-485 bus network.
4 The repeater is not required, only when there is more than 64 communications
equipment or communication distance is more than 800 meters.
Area 1 -- Serial setting area, choose the serial and press Start Working button, system will in operation, press Stop Working button,
system will stop working;
Area 2 -- The inquire area for air conditioner unit, it can be divided into the system inquire and user-defined group inquire, the inquired
unit will be displayed in area 4.
Area 3 -- Display area of single air conditioner indoor unit, select one of indoor units in area 4, then the area will display the name, ID
(address of indoor unit) , system belonged ,group belonged, current condition, the room temperature of indoor unit , failure etc.
Area 4 -- Display area of air conditioner group, as shown in above picture, it displayed all the indoor units in the group System01.
Area 5 -- Control area of air conditioner, it can control one single air conditioner and some air conditioner group, this will be described in
detail later.
Billing System
Software interface
Control Syetem
BMS System
Modbus
RS-485MODBUS
RS-485Device
BMS
MODBUS Gateway
MODBUS 02-63 MODBUS
Gateway01 Gateway64
System1 System64
Lonworks
Ethernet
BMS
Power system
Fire protection system
&OLPD8QR
iphone6
Remote Mode
Cloud
Server
iphone6
&OLPD8QR
iphone6
Home Mode
Features:
1.
air conditionercan connect to intelligent terminal through WIFI or GPRS network,customers can enjoy fun and convenience of
remote control the AC via iphone, ipad and other mobile terminals(Android and IOS) to control the AC at anytime and anywhere.
2.Thefunction of software on Mobile terminal includes mode control,temperature control, swing control, timing control.
3.Customers can set schedule to plan their day, also the scene mode can be set conveniently.
China
Chi
Chin
Ch
C h in
n a Mo
Mobile
M ob
bil e
bile China Mobile
China Mobile China Mobile
Control Syetem
Monitoring Software
Self-diagnosis software can be used as remote controller, it is recommended for commissioning. It can monitor the running state of the
outdoor and indoor units real time. And display the malfunctions, be convenient to do the commissioning and trouble-shooting work.
Control Syetem
Selection Software
To meet the customers' requirements, )ROSG;TU has developed the advanced selection software. The software provides quick and convenient
selectable options for users, supports multiple languages, greatly improves the selection and installation process.
1 Selecting indoor units Selecting indoor unit for project according the capacity, air flow volume and room information
Automatic selection suitable outdoor unit for project according to the capacity of indoor units,
2 Selecting outdoor units
the capacity ratio between indoor and outdoor unit, and the temperature of indoor and outdoor unit.
Every outdoor system can draw corresponding piping diagram. The system will auto select branch pipe,
3 Drawing piping diagram gas pipe and liquid pipe according to selected indoor and outdoor unit. The pipe length can be input
according to the project diagram if the project need. Ability compensation also can be displayed for the software.
Every outdoor system can draw wiring diagram. The wiring length can be input according to the project diagram
4 Drawing wiring diagram if the project need. Wring includes: power cable, signal cable and so on. Remote controller and wired controller
can be chosen according to the customer's demands.
Selecting BMS or The software can be used to select either BMS or centralized controller and draw connecting wiring diagram.
5 Centralized Controller
6 Output the report The report can be output in 3 kinds of forms, PDF, word and CAD.
Control Syetem
Branch Joints
)FG-00A )FG-12A
Gas side joint Gas side joint
)FG-24A )FG-34A
Gas side joint Gas side joint
Branch Joints
)FG-50A )FG-64A
Gas side joint Gas side joint
Nomenclature
HRV - 200 / 4
Power Supply
4:220-240V~, 1Ph, 50Hz
5:380-415V~, 3Ph, 50Hz
Air Flow Volum( m 3/h)
h
HRV-Heat
Features
1. HRV (Heat Recovery Ventilator) Adopt High Efficiency Heat Exchanged Core.
The heat exchanged core forming by special paper that be processed with chemical treatment, which could create the optimum result in temperature, humidity and
cooling recovery.
2. Energy Saving
Fresh air and exhaust air are crossed through the heat exchanger.
Temperature and humidity exchange happened in the heat recovery ventilator.
Fresh-air can get a great deal of energy from exhaust air.
3. Adopt Centrifugal Fan With Lower Power Consumption And Longer Air Supply Distance; Easy Control,
Friendly Operation.
Fresh air and exhaust air are crossed through the heat exchanger.
Temperature and humidity exchange happened in the heat recovery ventilator.
Fresh-air can get a great deal of energy from exhaust air.
Indoor
Outdoor
If outdoor temperature is lower than indoor, we don't need heat exchanging, but we need fresh air. We can choose by pass mode.
Remark: this mode is only available for HRV-200~1000.
Heat exchanging mode (Hi/Mid/Low fan speed can be chosen)
In this mode, supply air flow=exhaust air flow.
Auto mode
In this mode, the unit will run at heat exchange mode or by pass mode judged by outdoor temperature and indoor temperature with
low speed air flow.
Specification-HRV
Specification-HRV