0% found this document useful (0 votes)
223 views

ClimaUno VRF

El documento presenta a Clima Uno, una compañía italiana fundada hace más de 30 años dedicada al aire acondicionado. Clima Uno se ha distinguido por su excelente servicio al cliente y ofrece una amplia gama de productos innovadores para diferentes mercados, como edificios residenciales y comerciales. Su misión es definir la oferta internacional para el confort, estableciendo el bienestar y satisfacción individuales como objetivo principal para todo su personal. El documento también describe las características y funciones de los sistemas de refrigeración Cl

Uploaded by

Hassan ALkhaledy
Copyright
© © All Rights Reserved
We take content rights seriously. If you suspect this is your content, claim it here.
Available Formats
Download as PDF, TXT or read online on Scribd
0% found this document useful (0 votes)
223 views

ClimaUno VRF

El documento presenta a Clima Uno, una compañía italiana fundada hace más de 30 años dedicada al aire acondicionado. Clima Uno se ha distinguido por su excelente servicio al cliente y ofrece una amplia gama de productos innovadores para diferentes mercados, como edificios residenciales y comerciales. Su misión es definir la oferta internacional para el confort, estableciendo el bienestar y satisfacción individuales como objetivo principal para todo su personal. El documento también describe las características y funciones de los sistemas de refrigeración Cl

Uploaded by

Hassan ALkhaledy
Copyright
© © All Rights Reserved
We take content rights seriously. If you suspect this is your content, claim it here.
Available Formats
Download as PDF, TXT or read online on Scribd
You are on page 1/ 52

7523,&$/D& ,19(57(5 95)6<67(05

(57(5 50 Hz
Introduction
&OLPD8QRZDVIRXQGHGLQ,WDO\DUHVXOWRIVWUDWHJLFFRRSHUDWLRQEHWZHHQZLGHH[SHULHQFHGPDUNHWLQJSURIHVVLRQDOVZKR

KDYHGHGLFDWHGLQWKHILHOGRIDLUFRQGLWLRQLQJIRURYHU\HDUV

'XULQJWKHSDVW\HDU&OLPD8QRKDVGLVWLQJXLVKHGLWVHOIIRUFRQVFLRXVFXVWRPHUFDUHDQGH[FHOOHQFHLQDIWHUVDOHVVHUYLFHV
E\SURPRWLQJVHOOLQJDQGVHUYLFLQJDZLGHUDQJHRILQQRYDWLYHSURGXFWVVXLWDEOHIRUVSHFLILFPDUNHWVHJPHQWVOLNHUHVLGHQWLDO
DQGFRPPHUFLDOEXLOGLQJVFLQHPDVVSRUWFRPSOH[HVWUDGLQJFHQWHUVKRVSLWDOVIRRGLQGXVWULHVVKRSSLQJPDOOV

&OLPD8QRLVSUHVHQWLQ(XURSH0LGGOH(DVWDQG1RUWK$IULFD$OOSURGXFWVDUHRIIHUHGIRUPHGLXPWRKLJKDPELHQWFOLPDWHV
XSWR&XVLQJHFRIULHQGO\UHIULJHUDQWVDQG(XURSHDQFHUWLILHGWHFKQRORJ\ERWKIRUDQG+]

7KHGLVWULEXWLRQQHWZRUNDFFRXQWVIRURYHUSHRSOHDOOGHGLFDWHGWRFXVWRPHUFDUHDQGVDWLVIDFWLRQSURYLGLQJKLJKTXDOLW\
SURGXFWVDWDFRQYHQLHQWSULFHSDFNDJH

0LVVLRQ


 )RURYHUWKHSDVW\HDUVRIDFWLYLW\&OLPD8QRKDVGHILQHGWKH,QWHUQDWLRQDORIIHUWRFRPIRUWHVWDEOLVKLQJWKHLQGLYLGXDOZHOOEHLQJ
DQGVDWLVIDFWLRQDVWKHRQHPLVVLRQWRZKLFKDOOLWVVWDIIDQGSHUVRQQHODUHGHGLFDWHGZLWKWKHEHVWRIWKHLUNQRZOHGJH

&OLPD8QRPHDQVFXVWRPHUVFDUH VDWLVIDFWLRQ

&59&OLPD8QR5HIULJHUDQW9DULDEOH6\VWHP


&OLPD8QR'&,QYHUWHU95)V\VWHP:LWKZLGHFKRLFHRIRXWGRRUDQGLQGRRUXQLWFDQSURYLGHVXLWDEOH95)V\VWHPIRUGLIIHUHQW
DSSOLFDWLRQDUHDWRJLYH\RXDVHWRILQWHJUDWHGDLUFRQGLWLRQVROXWLRQDQGDQVZHUHGWKHQHHGVRIEXLOGLQJVL]HDQGLQWHULRUGHVLJQ
'XHWR+LJK7HFKQRORJ\'&,QYHUWHU&RPSUHVVRUV+LJK(IILHQF\LVDFKHLYHGDQGHQHUJ\VDYLQJFDQEHUHDOL]HG
0

Energy Saving

Hydrophilic
Dc lnverter
180Sine Wave Control Sleep Mode Aluminum Fin

With considerable advantages, DC Users can select sleep mode after The louvered hydrophilic aluminum
Inverter 180 sine wave driving pressing time-off button. This foil has improved by more than 10
technology has much wider range of function will adjust temperature % The refrigerant inlet and outlet
frequency and voltage, higher automatically, which makes a are separated, to ensure the sub-
energy efficiency, more smooth comfortable sleep environment. cooling, enhance the cooling
running and lower noise. capacity.

Comfort

Independent
Dehumidification 3D Air Flow Fast Cooling/Heating Auto Swing

With the independent dehumidificati- Combine vertical and horizontal auto Startup at high frequency increases Distributes cool/warm air to maxim-
on function, the unit can efficiently swing to ensure an even distribution cooling/heating capacity and reduces um area by moving horizontal and
dehumidify the room and give you of air flow throughout the room. time to reach set temperature, thus vertical flags automatically.
more comfort. you can enjoy cooling and heating in
seconds.

Anti-Cold-Air Follow Me Night Silent Function

When starting the heating operation, Atemperature sensor is built in the Outdoor unit records the highest
the fan speed is regulated automaticl- remote control, it will sense its surro- temperature with sensor and 7 hours
ly from the lowest speed to the preset unding temperature, so the unit can later after, it automatically runs in
level. This function can prevent cold achieve accurate and comfortable silent mode and lower the noise
air from blowing out at the beginning temperature control just like the air level.
of the operation, which avoids the conditioner is following you.
discomfort to the user.
0

Health

Fresh Air Intake Long-term Filter Self-Cleaning

Air outside can be led into the room The latest long-term filter ensures When this function is activated,ind-
via a connection pipe, which keeps better air quality. Meanwhile, the oor unit will running with special
the indoor air fresh and healthy. cleaning frequency has been combined mode to blow and dry
decreased, and maintenance is also indoor evaporator so as to keep
much easier. clean and healthy.

Reliability

EC
Compressor
Self-diagnosis Function Low Ambient Cooling Intelligent Defrosting Heating Belt

Once abnormal operation or parts With special designed PCB, outdoor Normal defrost functioncan only Auxiliary heating belt can increase
failure happen, the unit will monito- fan speed can be changed automati- EHoperated in certain time, but compressor oil temperature in
ring the failures, the microcomputer cally according to condensation &OLPD8QRcommercial air winter and prevent defrosting water
of air conditioner will switch off temperature. The air conditioner can FRQGLWLRQHU
Vi n t e l l i g e n t d e f r o s t accumulated, which improves heat
and protect the system automatically run cooling operation even when the FDQVWDUWautomatically according transfer efficiency.
when it happens. Meanwhile, the outdoor ambient temperature down WKHWRsurrounding condition.
error or protection code will be to -15.
displayed on the indoor unit.

Optional Electric Fire-proof


Heater Golden Fin Electric Box

Built-in auxiliary electric heater as Effectively prevent bacteria breeding Electrical control box adopts new
option, the heating performance will and improve heat transfer efficiency. design, which can meet the higher
be more powerful. The unique anti-corrosive golden fire safety requirement to prevent
coating on the condenser can the internal fire due to the electric
withstand the rain, salty air and other spark accident.
corrosive elements.
0

Convenience

26 cECO
24-hour Timer Built-in Drain Pump Dual Side Drainage Digital Tube Display

Users can turn on or turn off the air The built-in pump can lift theconde- Both left and right sides of the Easily for the running parameters
conditioner at any time in 24 hours nsing water up to 1200mm upmost indoor unit are possible for drainage checking and more convenient for
with remote controller or wireless from the drainage pan. hose connection, and it's easy for troubleshooting, digital tube
controller. installation with this function. displays work status such as indoor
temperature, setting temperature, the
mode of operation, etc.

MCGS

Remote Control Wired Control Central Control WIFI Control

Help users to control the air conditi- Help users to control the air condit- With the control function of weekly &OLPD8QRAC equipped with WIFI
oner easily, you can design your oner easily, the wired controller can timer, zone( or group) setting etc., Control technology, when connectiQJ
most comfortable settings with this be fixed on the wall and avoid misl- the centralized controller can to intelligent terminal, customersFDQ
controller. aying. It's mainly used for commerc- control 64 units with the RS485 enjoy fun and convenience of UHPRWH
ial zone and makes air conditioner wire connection units and adapter control via mobile phones, LSDGDQG
control more convenient. plate. other mobile terminals  $QGURLGDQG
,26 to control the $&DWDQ\WLPH
DQG anywhere.

Washable Filter Auto Restart Function

The indoor unit filter can be taken If the air conditioner breaks off
off to wash easily and it keeps clea- unexpectedly due to the power cut,
ning air all the time. it will restart with the previous setti-
ng mode automatically when the
power resume.
0

Indoor Unit:
CRV CA - H 028 / 4 R1 A

Design Series Code


Refrigerant Type
R1:R410a R22 Omitted
Power Supply
2:208-230V~, 1Ph, 60Hz 4:220-240V~, 1Ph, 50Hz
5:380-415V~, 3Ph, 50Hz 6:380-415V~,3Ph,60Hz
Cooling Capacity (kBtu/h)
HCooling & Heating
Indoor Unit Type
CAFour-way Cassette CFCeiling&Floor
LD Low ESP Duct MDMid ESP Duct
HDHigh ESP Duct WMWall Mounted
FA: Fresh Air Processer

h Refrigerant Variable AC

Outdoor Unit:
CRV - H 028 / 5 R1 M A

Design Series Code


M:Modular Outdoor Unit Non- Modular One Omitted
Refrigerant Type
R1:R410a R22 Omitted
Power Supply
2:208-230V~, 1Ph, 60Hz 4:220-240V~, 1Ph, 50Hz
5:380-415V~, 3Ph, 50Hz 6:380-415V~,3Ph,60Hz
9:208-230V~, 3Ph, 60Hz
Cooling Capacity (100W)
HCooling & Heating C: Cooling Only
h Refrigerant Variable AC
0

)RV III

Energy Saving Technology

1. The Industry's Leading IPLV Value


RV III achieves the industry's top class energy efficiency of cooling and heating by utilizing the advanced 180 sine wave DC Inverter

ARV III
driving technology, dual compressors parallel technology, patented energy-saving operation technology and improved performance of
heat exchanger. 100
%

6.17
6.2
80
6.08
6.1
6.03
60
Load capacity

6.0
5.9
5.9 5.85 40
5.81
5.8
20
5.7
0
5.6
8HP 10HP 12HP 14HP 16HP 18HP 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21
T h

Because the outdoor ambient temperature and indoor load is different at different times of day, most of time, the system works
under part load. So it is better to assess the energy saving performance using IPLV.
IPLV(C)=0.05EER(100%)+0.3EER(75%)+0.4EER(50%)+0.25EER(25%).

2. New Generation Of High-pressure Chamber DC Inverter Compressor


High performance, low sound DC compressor operates at a faster frequency, reducing start-up time. This helps the unit to bring the
room temperature to the set value quickly.

H-P:High pressure chamber compressor


H-P L-P L-P: Low pressure chamber compressor

The high pressure chamber compressor can make the oil circuiting with Intrinsic pressure difference, and ensure sufficient oil supply
when running at low frequency. The suction gas of low pressure chamber compressor will be heated when going through the scroll.
However, the suction gas of the high pressure chamber compressor directly back to the scroll, which makes the superheat of
refrigerant gas smaller and a high volume efficiency.
The motor of the low pressure chamber compressor is cooled by the suction refrigerant, which causes poor lubrication because of
the instability of the oil temperature under the low ambient temperature operation. However, the motor of the high pressure
chamber compressor is cooled by the discharge gas, and the unit can get a better heating performance.
The whole high pressure chamber of the high pressure chamber compressor can work as a composite muffler , so it can reduce the
discharge noise.
0

3. Sub-cooling technology
Prevent heat exchange between outlet and inlet17.6 sub-cooling.Enhance degree of sub cooling.
Enhance cooling capacity.Reduce the pressure resistance.
Ensure longer pipe length.

Plate heat exchanger Dual EXV

4. DC Brushless Fan Motor


DC brushless motor adjusts the fan speed according to the system
pressureenhance the efficiency by 45%. The super aero fan provides
a larger air volume and higher static pressure, and at the same time
ARV III

produces a lower noise level.

5. High Efficient Heat Exchanger


Optimized 2 to 1 refrigerant circuit design increase the Optimized fin design, reduces the water resistance and wind
heat exchanging efficiency and enhance the ratio of liquid resistance
which flow to the evaporator.
Normal refrigerant circuit

Gas Liquid refrigerant


I
refrigerant

2 to 1refringerant circuit

Gas
refrigerant Liquid refrigerant

Gas Liquid refrigerant


refrigerant

Enhance liquid refrigerant ratio

Convenience & Comfortable

1. Different Operation Modes


Add more operation mode for various applications. Through outdoor PCB switch easy change system operation mode.

Heating priority : System will work in heating mode only.Other


mode demand will no response Heating priority Cooling only
Cooling priority: System will work in cooling mode only.Other mode(default)

mode demand will no response


Heating only
First on priority: The first start indoor unit operation mode will Cooling priority mode

decide system operation , others different demand will no


response. First on priority Majority priority

Majority priority: System operation mode is decided by majority


demand.
0

2. Silence Operation
Outdoor unit quiet mode
By using optimized fan blades and the CFD(Computational Fluid Dynamics) technology, the product is equipped with the
night low-noise operation function. Provide more quiet operation during the night. Minimum operation noise only 45
dB(A).

Night silent operation ( Compare with normal operation, silent operation noise reduce 12dB(A).

ARV III
Super mute unit silent running Super mute unit bare machine running silent mode at night

dB(A) dB(A) dB(A) dB(A) dB(A) dB(A) dB(A) dB(A)

0 20 dB(A)

Leaves rustling sound Quiet bedroom Quiet library Office

3. Humanization Design
Special design economic locking function, through outdoor PCB switch setting. If work in
economic lock, AC lowest work cooling temperature will keep in 26 and highest heating
temperature keep 20. 26
Save energy and keep provide comfortable.

4. VIP Design 5. Precise Temperature Control


Special VIP control function, the VIP room will decide the whole The unit uses PI calculation principle to calculate the percentage
system operation mode, prior to other mode or economic of indoor capacity demand according to indoor temperature
locking function, ensure the priority of the important room. fluctuations, to perform real-time control to the compressor
operating frequency and achieve precision control to the indoor
temperature.
Setting humidity
0

6. Intelligent defrosting

intelligent defrosting technique extends the heating operation and decrease the frequency of defrosting. Result in stable
room temperature, offer comfort life.
Temp

24
20 Comfortable
18
Normal defrosting Cold

10
Defrosting Heating Operation Defrosting Heating Operation Defrosting Heating Operation Time
Temp

24
20 Comfortable
Comfort
f able
18
Conventional
Cold
intelligent defrosting
10
Defrost
Defros
D efrost
efros
s iing
Defrosting g Heating Operation Defrost
Defro
D efros
efro
o ing
g
Defrosting Heating Operation Defros
Defrost
Defr
Defro
D efr
efro
fr
f ing
g
Defrosting Heating Operation Time
e
Temp

24
20 Comfortable
18
intelligent Cold
Co
Co
defrosting
10
Defrosting Heating
in
n Operation Defrosting Heating Operation Defrost
f
fr ing
Defrosting Heating Operation
Operat
erat
e rrattion
io
io
on Time
ARV III

Easy Installation & Maintenance

1. Wide Operation Range 2. Convenient Piping Design


The unit could operate perfectly between 52 in hot Corresponding selection software can easily select the
summer and -20 in cold winter making you feel like spring outdoor and indoor units, and automatically calculate the
all year around, advanced system design and strict system piping size and the branch model. It can output the select
matching and test. (cooling in -20 ) report with material .

ClimaUno Project Express V1.0.4 &OLPD8QRProject Express V1.0.4

52 -20

3. Changeable ESP
Optimized fan provide outdoor unit up to 82Pa static pressure. Outdoor units can be installed in the service floor or facility
room.
0 pa 20 pa 20-82 pa

15m

4. Non-polar Communication
No polar in communication wire ,easy installation and commissioning.

5. Auto Addressing
The outdoor units distribute indoor system address automatically. No need manually setting. More convenient and saving the installation
time.

6. Convenient Piping Design


Corresponding selection software can easily select the outdoor and indoor units, and automatically calculate the piping size and the
branch model. It can output the select report with material .

7. Extend Pipe length And Height


Because of using DC inverter control technology and sub-cooling control circuit technology, it is possible to design a system with longer
piping length and world-class elevation difference. The designer's working time is reduced and allowing more efficient design.

15m 90m

ARV III
90m
Max. Total piping length 1000m
Max. Actual piping length 175m
Max. Level dierence between indoor units 15m
Max. Level dierence between ODU and IDU units 90m
Max. Level dierence between ODU and ODU units 5m
Max. piping length from 1st indoor Branch to the farthest indoor unit 40m

Reliable & Stable

1. Module Alternate Operation


In one combination system ,any module could run as the master unit according to the running time.
Balance the life of the outdoor units in one system.

2. Back-up Running 3. Black Box Function


As one of outdoor units breaks down ,the rest of outdoor The PCB could record 30 minutes running information before
units in the same refrigerant system can turn to operation the error occur .It's convenient for the trouble shooting.
urgently.

T
Normal start-up sequence:1--2.
Emergency back-up start-up sequence:1--3.


More Combination
8/10/12HP 14/16/18HP 20/22/24/26/28/30/32HP 34/36/38/40/42/44/46/48HP

50/52/54/56/58/60/62/64/66/68/70/72HP
ARV III

Flexible Outdoor Unit Combination


kW HP 8HP 10HP 12HP 14HP 16HP 18HP
25.2 8
28.0 10
33.5 12
40.0 14
45.0 16
50.4 18
56.0 20
61.5 22
68.0 24
73.5 26
78.5 28
85.0 30
90.0 32
96.0 34
101.0 36
108.0 38
113.0 40
120.0 42
125.0 44
130.0 46
135.0 48
141.0 50
146.0 52
151.5 54
158.0 56
163.5 58
170.0 60
175.0 62
180.0 64
185.4 66
190.8 68
196.2 70
201.6 72

)8V III Outdoor Units

Specification-)RV III 50Hz

Model Outdoor CRV-H250/5R1MA CRV-H280/5R1MA CRV-H330/5R1MA CRV-H400/5R1MA CRV-H450/5R1MA CRV-H500/5R1MA

ARV III
Cooling kW 25.2 28.0 33.5 40.0 45.0 50.4
Capacity
Heating kW 28.0 31.5 37.5 45.0 50.0 55.5
Power Supply V~,Hz,Ph 380~415,50,3 380~415,50,3 380~415,50,3 380~415,50,3 380~415,50,3 380~415,50,3
Cooling Power Input kW 5.8 7.1 8.9 11.3 12.9 14.3
Electric Data Heating Power Input kW 6.1 7.6 9.1 11.2 12.8 15.0
Cooling Current A 8.8 10.8 13.5 18.7 21.1 23.3
Heating Current A 9.3 11.5 13.8 16.9 19.5 22.8
Air Flow Volume m /h
3
12000 12000 12000 72502 75002 75002
Performance
Noise Level dB(A) 45-58 45-58 45-58 47-61 47-61 47-61
Vertical Pipe Length m 90 90 90 90 90 90
Actual Pipe Length m 165 165 165 165 165 165
Piping Limite
Equivalent Pipe Length m 190 190 190 190 190 190
Total Pipe length m 1000 1000 1000 1000 1000 1000
Max. No. of Indoor Units unit 13 16 19 23 26 30
Connection Ratio % 50~130 50~130 50~130 50~130 50~130 50~130
Net mm 930x765x1680 930x765x1680 930x765x1680 13407651680 13407651680 13407651680
Dimension(WxDxH)
Packing mm 9808101850 9808101850 9808101850 14008101850 14008101850 14008101850
Net kg 223 223 248 303 303 318
Weight
Gross kg 243 243 268 325 325 340
Refrigerant Type R410a R410a R410a R410a R410a R410a
Liquid Side mm(inch) 12.7(1/2) 12.7(1/2) 12.7(1/2) 12.7(1/2) 12.7(1/2) 12.7(1/2)
Pipe Diameter
Gas Side mm(inch) 22.2(7/8) 22.2(7/8) 22.2(7/8) 28.6(9/8) 28.6(9/8) 28.6(9/8)
Cooling -15~52 -15~52 -15~52 -15~52 -15~52 -15~52
Operation Range
Heating -20~24 -20~24 -20~24 -20~24 -20~24 -20~24
Stuffing Quantity 20/40/40H unit 14/28/28 14/28/28 14/28/28 11/22/22 11/22/22 11/22/22

Notes
1.Cooling Capacity: Indoor temperature 27 DB/19 WB;Outdoor temperature:35 DB/24 WB.
2.Heating Capacity:Indoor temperature 20 DB;Outdoor temperature:7 DB/6 WB.
3.Piping Length:Equivalent piping length:7.5m,level differernce:0m.
4.Anechoic chamber conversion value,measured in test room.During actual operation.These values are normally somewhat higher as a result
of ambient conditons.
5.The above designs and specifications are subject to change of product improvement without prior notice.


Four-way Cassette IDU

Standard Optional

Indoor Units - CA
1. Ultra Slim Design 2. 5-segment Heat Exchanger
Only 250mm in height, save installation space. Innovative exchanger design enlarges the heat
exchanging area and increase the heat exchanging
efficiency by 10% to 15%.

250mm

3. Quiet Operation 4. Fresh Air Intake


Innovative 3D spiral wind leaf increases air volume and Fresh air makes indoor air healthy and comfortable.
makes the air supply more quietly and smoothly.

470mm

Fresh air intake




5. Optimized Electric Box


Better fire-proof and easy to maintenance.

6. Digital Tube Display


Digital tube displays all contents: indoor temperature, setting temperature, operation mode, etc.Clearly to check the
running status, more convenient for trouble shooting .
Indoor Units - CA

7. Long Term Filter


The long-term air filter ensures better air quality and decreases the cleaning frequency.

8. Built-in Water Drainage Pump


The built-in pump can lift condensing water up to 1200mm high from the drainage pan.

1200mm

Four-way Cassette Indoor Units
ts

Specification-Four-way Cassette IDU 50Hz

Model Indoor RVCA-H028/4R1A RVCA-H036/4R1A RVCA-H045/4R1A RVCA-H056/4R1A RVCA-H071/4R1B RVCA-H080/4R1B


Cooling kW 2.8 3.6 4.5 5.6 7.1 8.0
Capacity
Heating kW 3.0 4.3 5.0 6.3 8.0 10.0
Power Supply V~,Hz,Ph 220~240,50,1 220~240,50,1 220~240,50,1 220~240,50,1 220~240,50,1 220~240,50,1
Electric Data
Rated Power W 70 70 80 80 100 100
Air Flow Volume(Hi/Mid/Low) m3/h 620/496/434 620/496/434 850/680/595 850/680/595 1250/1040/910 1250/1040/910
Performance
Noise Level(Hi/Mid/Low) dB(A) 38/35/32 38/35/32 39/36/33 39/36/33 38/34/30 38/34/30
Net(Body) mm 593x615x263 593x615x263 593x615x263 593x615x263 835x835x250 835x835x250
Packing(Body) mm 700x700x330 700x700x330 700x700x330 700x700x330 910x910x310 910x910x310
Dimension(WxDxH)
Net(Panel) mm 650x650x55 650x650x55 650x650x55 650x650x55 950x950x55 950x950x55
Packing(Panel) mm 710x710x80 710x710x80 710x710x80 710x710x80 1000x1000x100 1000x1000x100
Net(Body) kg 20 20 20 20 27 27
Gross(Body) kg 25 25 25 25 34 34
Weight
Net(Panel) kg 3 3 3 3 5 5
Gross(Panel) kg 5 5 5 5 7 7
Refrigerant Type R410a R410a R410a R410a R410a R410a
Liquid Side mm(inch) 6.35(1/4) 6.35(1/4) 6.35(1/4) 6.35(1/4) 9.52(3/8) 9.52(3/8)
Pipe Diameter Gas Side

Indoor Units-CA ARV III


mm(inch) 12.7(1/2) 12.7(1/2) 12.7(1/2) 12.7(1/2) 15.88(5/8) 15.88(5/8)
Drainage mm R3/4in(DN20) R3/4in(DN20) R3/4in(DN20) R3/4in(DN20) R3/4in(DN20) R3/4in(DN20)
Stuffing Quantity 20/40/40H unit 135/264/306 135/264/306 135/264/306 135/264/306 64/134/152 64/134/152

Specification-Four-way Cassette IDU 50Hz

Model Indoor RVCA-H090/4R1B RVCA-H100/4R1B RVCA-H112/4R1B RVCA-H125/4R1B RVCA-H140/4R1B


Cooling kW 9.0 10.0 11.2 12.5 14.0
Capacity
Heating kW 11.0 12.0 12.8 13.3 15.0
Power Supply V~,Hz,Ph 220~240,50,1 220~240,50,1 220~240,50,1 220~240,50,1 220~240,50,1
Electric Data
Rated Power W 176 176 200 200 200
Air Flow Volume(Hi/Mid/Low) m3/h 1500/1200/1050 1500/1200/1050 1800/1440/1260 1800/1440/1260 1800/1440/1260
Performance
Noise Level(Hi/Mid/Low) dB(A) 41/37/34 41/37/34 41/38/35 41/38/35 41/38/35
Net(Body) mm 835x835x250 835x835x250 835x835x290 835x835x290 835x835x290
Packing(Body) mm 910x910x310 910x910x310 910x910x350 910x910x350 910x910x350
Dimension(WxDxH)
Net(Panel) mm 950x950x55 950x950x55 950x950x55 950x950x55 950x950x55
Packing(Panel) mm 1000x1000x100 1000x1000x100 1000x1000x100 1000x1000x100 1000x1000x100
Net(Body) kg 28 28 30 30 30
Gross(Body) kg 35 35 37 37 37
Weight
Net(Panel) kg 5 5 5 5 5
Gross(Panel) kg 7 7 7 7 7
Refrigerant Type R410a R410a R410a R410a R410a
Liquid Side mm(inch) 9.52(3/8) 9.52(3/8) 9.52(3/8) 9.52(3/8) 9.52(3/8)
Pipe Diameter Gas Side mm(inch) 15.88(5/8) 15.88(5/8) 15.88(5/8) 15.88(5/8) 15.88(5/8)
Drainage mm R3/4in(DN20) R3/4in(DN20) R3/4in(DN20) R3/4in(DN20) R3/4in(DN20)
Stuffing Quantity 20/40/40H unit 64/134/152 64/134/152 60/122/136 60/122/136 60/122/136
Notes
1.Cooling Capacity: Indoor temperature 27DB/19WB;Outdoor temperature:35DB/24WB.
2.Heating Capacity:Indoor temperature 20DB;Outdoor temperature:7DB/6 WB.
3.Piping Length:Equivalent piping length:7.5m,level differernce:0m.
4.Sound level is measured at 1.4m below the unit.
5.The above designs and specifications are subject to change of product improvement without prior notice.


Ceiling & Floor IDU

AUTO

MODE

POWER

Standard Optional

1. 4D Air Swing 2. Ultra Slim Design


Vertical and horizontal swing makes air below to every The thickness is only 205mm, save installation space.
corner of the room.
205mm

Indoor Units - CF
3. Optional Noble Belt 4. Long Term Filter
Noble belts supply luxury appearance. The long-term air filter ensures better air quality and
decreases the cleaning frequency.

5. Innovative Centrifugal Fan 6. Flexible Installation


All units are equipped with 3-speed fan mode, adjusting Can be vertically installed against the wall or horizontally
the air flow rate in accordance with the ceiling height. installed under the ceiling.
Innovative centrifugal fan provides larger air volume but
lower noise, making the air supply more quietly and
smoothly. y


Ceiling&Floor Indoor Units

Specification-Ceiling&Floor IDU 50Hz

Model Indoor RVCF-H028/4R1A RVCF-H036/4R1A RVCF-H045/4R1A RVCF-H056/4R1A RVCF-H071/4R1A RVCF-H080/4R1A


Cooling kW 2.8 3.6 4.5 5.6 7.1 8.0
Capacity
Heating kW 3.0 4.3 5.0 6.0 8.0 10.0
Power Supply V~,Hz,Ph 220~240,50,1 220~240,50,1 220~240,50,1 220~240,50,1 220~240,50,1 220~240,50,1
Electric Data
Rated Power W 80 80 80 80 140 140
Air Flow Volume(Hi/Mid/Low) m3/h 450/360/315 630/504/441 950/760/665 950/760/665 1300/1040/910 1500/1200/1050
Performance
Noise Level(Hi/Mid/Low) dB(A) 37/34/31 39/36/33 42/39/36 42/39/36 45/42/39 47/44/41
Dimension(WxDxH) Net(Body) mm 929660205 929660205 929660205 929660205 1280660205 1280660205
Packing(Body) mm 1010720290 1010720290 1010720290 1010720290 1360720290 1360720290
Net(Body) kg 26 26 26 26 35 35
Weight
Gross(Body) kg 29 29 29 29 39 39
Refrigerant Type R410a R410a R410a R410a R410a R410a
Liquid Side mm(inch) 6.35(1/4) 6.35(1/4) 6.35(1/4) 6.35(1/4) 9.52(3/8) 9.52(3/8)
Pipe Diameter Gas Side mm(inch) 12.7(1/2) 12.7(1/2) 12.7(1/2) 12.7(1/2) 15.88(5/8) 15.88(5/8)
Drainage mm R3/4in(DN20) R3/4in(DN20) R3/4in(DN20) R3/4in(DN20) R3/4in(DN20) R3/4in(DN20)
Stuffing Quantity 20/40/40H unit 136/272/306 136/272/306 136/272/306 136/272/306 96/200/225 96/200/225
Indoor Units-CF

Specification-Ceiling&Floor IDU 50Hz

Model Indoor RVCF-H090/4R1A RVCF-H100/4R1A RVCF-H112/4R1A RVCF-H125/4R1A RVCF-H140/4R1A


Cooling kW 9.0 10.0 11.2 12.5 14.0
Capacity
Heating kW 11.0 12.0 12.8 13.3 15.0
Power Supply V~,Hz,Ph 220~240,50,1 220~240,50,1 220~240,50,1 220~240,50,1 220~240,50,1
Electric Data
Rated Power W 140 140 210 210 210
Air Flow Volume(Hi/Mid/Low) m3/h 1500/1200/1050 1500/1200/1050 1800/1440/1260 1800/1440/1260 1800/1440/1260
Performance
Noise Level(Hi/Mid/Low) dB(A) 47/44/41 47/44/41 48/45/42 48/45/42 48/45/42
Dimension(WxDxH) Net(Body) mm 1280660205 1280660205 1631660205 1631660205 1631660205
Packing(Body) mm 1360720290 1360720290 1710720290 1710720290 1710720290
Net(Body) kg 35 35 45 45 45
Weight
Gross(Body) kg 39 39 51 51 51
Refrigerant Type R410a R410a R410a R410a R410a
Liquid Side mm(inch) 9.52(3/8) 9.52(3/8) 9.52(3/8) 9.52(3/8) 9.52(3/8)
Pipe Diameter Gas Side mm(inch) 15.88(5/8) 15.88(5/8) 15.88(5/8) 15.88(5/8) 15.88(5/8)
Drainage mm R3/4in(DN20) R3/4in(DN20) R3/4in(DN20) R3/4in(DN20) R3/4in(DN20)
Stuffing Quantity 20/40/40H unit 96/200/225 96/200/225 80/160/180 80/160/180 80/160/180
Notes
1.Cooling Capacity: Indoor temperature 27 DB/19 WB;Outdoor temperature:35 DB/24WB.
2.Heating Capacity:Indoor temperature 20 DB;Outdoor temperature:7 DB/6 WB.
3.Piping Length:Equivalent piping length:7.5m,level differernce:0m.
4.Floor standing:Sound level is measured 1m from air-outlet in horizontal distance,1m above the floor in vertical distance,
Ceiling mounted: Sound level is measured 1m from air-outlet in horizontal distance,1m from air-outlet in vertical distance.
5.The above designs and specifications are subject to change of product improvement without prior notice.


Slim Duct IDU

AUTO

MODE

POWER

Standard Optional
Indoor Units - SD

1. Ultra Slim Design


The thickness is only 185mm, save installation space. 185mm

2. Built In Water Pump


The built-in pump can lift condensing water up to 700mm high from the drainage pan.

derrick

700mm

The ceiling

3. Silence Operation
Innovative centrifugal fan for large diameter and a new design of the spiral duct system equipped with high-quality motor at the same
time, making the air supply more quietly and smoothly. The lowest noise is 18 db(A).

16 18 30 40
bd(A) bd(A) bd(A) bd(A)

Leaves rustling sound Quiet bedroom Quiet library

The lowest operation noise is 18 db(A)the industry's most advanced mute value.


4. Flexible Air Intake Options


Air intake from rear as standard, from bottom is optional.
The size of the plate from bottom is the same as the flange from back, which makes it convenient to change installation style due to
different decoration requirements.

Air intake from below Air intake from rear

5. 2 Ways Draining Connection


There two outlet in left and right, both left and right sides of unit are possible for drainage hose connection, easy for installation.

The right outlet


The left outlet

6. Digital Tube Display (Optional)


Digital tube displays all contents: indoor temperature, setting temperature, operation mode, etc.
Clearly to check the running status, more convenient for trouble shooting .

Slim Duct Indoor Units

Specification-Slim Duct IDU 50Hz

Model Indoor RVSD-H022/4R1A RVSD-H028/4R1A RVSD-H036/4R1A RVSD-H045/4R1A RVSD-H056/4R1A RVSD-H071/4R1A


Cooling kW 2.2 2.8 3.6 4.5 5.6 7.1
Capacity
Heating kW 2.5 3.0 4.3 5.0 6.0 8.0
Power Supply V~,Hz,Ph 220~240,50,1 220~240,50,1 220~240,50,1 220~240,50,1 220~240,50,1 220~240,50,1
Electric Data
Rated Power W 59 59 65 91 91 113
Air Flow Volume(Hi/Mid/Low) m3/h 480/390/320 480/390/320 560/430/390 850/680/575 850/680/575 1000/810/685
Performance Noise Level(Hi/Mid/Low) dB(A) 30/26/23 30/26/23 32/28/25 38/35/32 38/35/32 39/36/32
External Static Pressure(ESP) Pa 10/30 10/30 10/30 10/30 10/30 10/30
Net(Body) mm 840460185 840460185 840460185 1160460185 1160460185 1160460185
Dimension(WxDxH)
Packing(Body) mm 1030545250 1030545250 1030545250 1350545250 1350545250 1350545250
Net(Body) kg 15.5 15.5 16.5 20 20 22
Weight
Gross(Body) kg 19 19 20 24 24 26
Refrigerant Type R410a R410a R410a R410a R410a R410a
Liquid Side mm(inch) 6.35(1/4) 6.35(1/4) 6.35(1/4) 6.35(1/4) 6.35(1/4) 9.52(3/8)
Pipe Diameter Gas Side mm(inch) 9.52(3/8) 9.52(3/8) 12.7(1/2) 12.7(1/2) 12.7(1/2) 15.88(5/8)
Drainage mm R3/4in(DN20) R3/4in(DN20) R3/4in(DN20) R3/4in(DN20) R3/4in(DN20) R3/4in(DN20)
Stuffing Quantity 20/40/40H unit 198/396/440 198/396/440 198/396/440 144/297/330 144/297/330 144/297/330
Indoor Units-SD

Notes
1.Cooling Capacity: Indoor temperature 27 DB/19 WB;Outdoor temperature:35 DB/24 WB.
2.Heating Capacity:Indoor temperature 20 DB;Outdoor temperature:7 DB/6 WB.
3.Piping Length:Equivalent piping length:7.5m,level differernce:0m.
4.Sound level is measured at 1.4m below the air outlet.
5.The above designs and specifications are subject to change of product improvement without prior notice.


Low ESP Duct IDU

Standard Optional

1. Fresh Air Intake 2. Built In Water Pump (Optional)


Fresh air makes indoor air healthy and comfortable. The built-in pump can lift condensing water up to 1200mm high
from the drainage pan.

3. Flexible Air Intake Options 4. Standard Accessories


Air intake from rear as standard, from bottom is optional. For all models, return air bellow and air filter are standard
The size of the plate from bottom is the same as the flange from configuration.
back, which makes it convenient to change installation style due
to different decoration requirements.

Low ESP Duct Indoor Units

Specification-Low ESP Duct IDU 50Hz

Model Indoor RVLD-H022/4R1A RVLD-H028/4R1A RVLD-H036/4R1A RVLD-H045/4R1A RVLD-H056/4R1A RVLD-H071/4R1A


Cooling kW 2.2 2.8 3.6 4.5 5.6 7.1
Capacity
Heating kW 2.5 3.0 4.3 5.0 6.0 8.0
Power Supply V~,Hz,Ph 220~240,50,1 220~240,50,1 220~240,50,1 220~240,50,1 220~240,50,1 220~240,50,1
Electric Data
Rated Power W 45 45 75 137 137 187
Air Flow Volume(Hi/Mid/Low) m3/h 420/336/294 420/336/294 580/464/406 860/688/602 860/688/602 1200/960/840
Performance Noise Level(Hi/Mid/Low) dB(A) 36/33/30 36/33/30 38/35/32 40/37/34 40/37/34 42/39/36
External Static Pressure(ESP) Pa 12/30 12/30 12/30 12/30 12/30 12/30
Net(Body) mm 880x547x240 880x547x240 880x547x240 1110x547x240 1110x547x240 1305x547x240
Dimension(WxDxH)
Packing(Body) mm 980x620x280 980x620x280 980x620x280 1210x620x280 1210x620x280 1400x620x280
Net(Body) kg 22.5 22.5 22.5 31 31 35.5
Weight
Gross(Body) kg 26 26 26 35 35 37
Refrigerant Type R410a R410a R410a R410a R410a R410a
Liquid Side mm(inch) 6.35(1/4) 6.35(1/4) 6.35(1/4) 6.35(1/4) 6.35(1/4) 9.52(3/8)
Pipe Diameter Gas Side mm(inch) 9.52(3/8) 9.52(3/8) 12.7(1/2) 12.7(1/2) 12.7(1/2) 15.88(5/8)
Drainage mm R3/4in(DN20) R3/4in(DN20) R3/4in(DN20) R3/4in(DN20) R3/4in(DN20) R3/4in(DN20)
Stuffing Quantity 20/40/40H unit 168/344/387 168/344/387 168/344/387 104/224/252 104/224/252 104/216/243
Indoor Units-LD

Notes
1.Cooling Capacity: Indoor temperature 27 DB/19WB;Outdoor temperature:35 DB/24WB.
2.Heating Capacity:Indoor temperature 20 DB;Outdoor temperature:7 DB/6WB.
3.Piping Length:Equivalent piping length:7.5m,level differernce:0m.
4.Sound level is measured at 1.4m below the air outlet.
5.The above designs and specifications are subject to change of product improvement without prior notice.


Mid ESP Duct IDU

Standard Optional

1. Ultra Slim Design


Only 290mm in height, save installation space.

Indoor Units - MD
290mm

2. Fresh Air Intake


Fresh air makes indoor air healthy and comfortable.

3. Built In With Water Pump (Optional)


The built-in pump can lift condensing water up to 1200mm high from the drainage pan.


4. Flexible Air Intake Options


Air intake from rear as standard, from bottom is optional.
The size of the plate from bottom is the same as the flange from back, which makes it convenient to change installation
style due to different decoration requirements.

5. Standard Accessories
Return air box and air filter are standard for all models.
Indoor Units - MD

6. Optional ESP
50Pa and 80Pa can be freely chosen.


Mid ESP Duct Indoor Units

Specification-Mid ESP Duct IDU 50Hz

Model Indoor RVMD-H045/4R1A RVMD-H056/4R1A RVMD-H071/4R1A RVMD-H080/4R1A RVMD-H090/4R1A


Cooling kW 4.5 5.6 7.1 8.0 9.0
Capacity
Heating kW 5.0 6.0 8.0 10.0 11.0
Power Supply V~,Hz,Ph 220~240,50,1 220~240,50,1 220~240,50,1 220~240,50,1 220~240,50,1
Electric Data
Rated Power W 150 150 220 250 250
Air Flow Volume(Hi/Mid/Low) m3/h 950/760/665 950/760/665 1200/960/840 1500/1200/1050 1500/1200/1050
Performance Noise Level(Hi/Mid/Low) dB(A) 42/39/37 42/39/37 45/42/39 48/45/42 48/45/42
External Static Pressure(ESP) Pa 50/80 50/80 50/80 50/80 50/80
Net(Body) mm 890x785x290 890x785x290 890x785x290 890x785x290 890x785x290
Dimension(WxDxH)
Packing(Body) mm 1100x870x360 1100x870x360 1100x870x360 1100x870x360 1100x870x360
Net(Body) kg 35 35 37 37 37
Weight
Gross(Body) kg 41 41 43 43 43
Refrigerant Type R410a R410a R410a R410a R410a
Liquid Side mm(inch) 6.35(1/4) 6.35(1/4) 9.52(3/8) 9.52(3/8) 9.52(3/8)
Pipe Diameter Gas Side mm(inch) 12.7(1/2) 12.7(1/2) 15.88(5/8) 15.88(5/8) 15.88(5/8)
Drainage mm R3/4in(DN20) R3/4in(DN20) R3/4in(DN20) R3/4in(DN20) R3/4in(DN20)
Stuffing Quantity 20/40/40H unit 72/156/182 72/156/182 72/156/182 72/156/182 72/156/182

Indoor Units - MD
Specification-Mid ESP Duct IDU 50Hz

RVMD-H100/4R1A RVMD-H112/4R1A RVMD-H125/4R1A RVMD-H140/4R1A RVMD-H150/4R1A


Cooling kW 10.0 11.2 12.5 14.0 15.0
Heating kW 12.0 12.8 13.3 15.0 16.0
Power Supply V~,Hz,Ph 220~240,50,1 220~240,50,1 220~240,50,1 220~240,50,1 220~240,50,1
Electric Data
Rated Power W 250 320 320 320 320
Air Flow Volume(Hi/Mid/Low) m3/h 1500/1200/1050 2000/1600/1400 2000/1600/1400 2000/1600/1400 2200/1760/1540
Performance Noise Level(Hi/Mid/Low) dB(A) 48/45/42 51/43/40 51/43/40 51/43/40 51/43/40
External Static Pressure(ESP) Pa 50/80 50/80 50/80 50/80 50/80
Net(Body) mm 890x785x290 1250x785x290 1250x785x290 1250x785x290 1250x785x290
Dimension(WxDxH)
Packing(Body) mm 1100x870x360 1460x870x360 1460x870x360 1460x870x360 1460x870x360
Net(Body) kg 37 53 53 53 53
Weight
Gross(Body) kg 43 60 60 60 60
Refrigerant Type R410a R410a R410a R410a R410a
Liquid Side mm(inch) 9.52(3/8) 9.52(3/8) 9.52(3/8) 9.52(3/8) 9.52(3/8)
Pipe Diameter Gas Side mm(inch) 15.88(5/8) 15.88(5/8) 15.88(5/8) 15.88(5/8) 15.88(5/8)
Drainage mm R3/4in(DN20) R3/4in(DN20) R3/4in(DN20) R3/4in(DN20) R3/4in(DN20)
Stuffing Quantity 20/40/40H unit 72/156/182 60/126/147 60/126/147 60/126/147 60/126/147
Notes
1.Cooling Capacity: Indoor temperature 27DB/19 WB;Outdoor temperature:35 DB/24 WB.
2.Heating Capacity:Indoor temperature 20 DB;Outdoor temperature:7DB/6 WB.
3.Piping Length:Equivalent piping length:7.5m,level differernce:0m.
4.Sound level is measured at 1.4m below the air outlet.
5.The above designs and specifications are subject to change of product improvement without prior notice.


High ESP Duct IDU

Standard Optional

1. Fresh Air Intake 2. Applicable To A Variety


V Of RoomTypes
Fresh air makes indoor air healthy and comfortable.
rtable. Specific ESP design can be ap
applied to various room types
easily, like rooms with L type or U type; the air outlet can be

Indoor Units - HD
indoo unit, so the air flow can be
set separately from the indoor
equally distributed even the room is in irregular structure.

3. Long Distance Air Supply


High ESP makes the air supply distance up to 50m.


High ESP Duct Indoor Units

Specification-High ESP Duct IDU 50Hz

Model Indoor RVHD-H112/4R1A RVHD-H125/4R1A RVHD-H140/4R1A RVHD-H150/4R1A


Cooling kW 11.2 12.5 14.0 15.0
Capacity
Heating kW 12.8 13.3 15.0 16.0
Power Supply V~,Hz,Ph 220~240,50,1 220~240,50,1 220~240,50,1 220~240,50,1
Electric Data
Rated Power W 600 600 600 600
Air Flow Volume(Hi/Mid/Low) m3/h 2000/1600/1400 2000/1600/1400 2000/1600/1400 2000/1600/1400
Performance Noise Level(Hi/Mid/Low) dB(A) 60/57/51 60/57/51 60/57/51 60/57/51
External Static Pressure(ESP) Pa 196 196 196 196
Net(Body) mm 1200x719x380 1200x719x380 1200x719x380 1200x719x380
Dimension(WxDxH)
Packing(Body) mm 1235x760x415 1235x760x415 1235x760x415 1235x760x415
Net(Body) kg 56 56 56 56
Weight
Gross(Body) kg 59 59 59 59
Refrigerant Type R410a R410a R410a R410a
Liquid Side mm(inch) 9.52(3/8) 9.52(3/8) 9.52(3/8) 9.52(3/8)
Pipe Diameter Gas Side mm(inch) 19.05(3/4) 19.05(3/4) 19.05(3/4) 19.05(3/4)
Drainage mm R3/4in(DN20) R3/4in(DN20) R3/4in(DN20) R3/4in(DN20)
Stuffing Quantity 20/40/40H unit 65/135/162 65/135/162 65/135/162 65/135/162
Indoor Units - HD

Specification-High ESP Duct IDU 50Hz

Model Indoor RVHD-H220/4R1A RVHD-H280/4R1A RVHD-H450/5R1A RVHD-H560/5R1A


Cooling kW 22.0 28.0 45.0 56.0
Capacity
Heating kW 24.5 31.0 49.5 61.5
Power Supply V~,Hz,Ph 220~240,50,1 220~240,50,1 380~415,50,3 380~415,50,3
Electric Data
Rated Power W 1050 1050 2220 2220
Air Flow Volume(Hi/Mid/Low) m3/h 4000/3200/2600 4000/3200/2600 8000 8000
Performance Noise Level(Hi/Mid/Low) dB(A) 60/55/53 60/56/54 63 63
External Static Pressure(ESP) Pa 220 220 200 200
Net(Body) mm 1755x915x645 1755x915x645 2115x990x855 2115x990x855
Dimension(WxDxH)
Packing(Body) mm 1880x940x805 1880x940x805 2225x1025x1015 2225x1025x1015
Net(Body) kg 130 130 225 225
Weight
Gross(Body) kg 150 150 260 260
Refrigerant Type R410a R410a R410a R410a
Liquid Side mm(inch) 9.52(3/8)x2 9.52(3/8)x2 12.7(1/2)x2 12.7(1/2)x2
Pipe Diameter Gas Side mm(inch) 19.05(3/4)x2 19.05(3/4)x2 22.2(7/8)x2 22.2(7/8)x2
Drainage mm DN25 DN25 DN25 DN25
Stuffing Quantity 20/40/40H unit 12/24/36 12/24/36 10/22/22 10/22/22
Notes
1.Cooling Capacity: Indoor temperature 27DB/19WB;Outdoor temperature:35 DB/24WB.
2.Heating Capacity:Indoor temperature 20 DB;Outdoor temperature:7 DB/6 WB.
3.Piping Length:Equivalent piping length:7.5m,level differernce:0m.
4.Sound level is measured at 1.4m below the air outlet.
5.The above designs and specifications are subject to change of product improvement without prior notice.


Fresh Air Processor IDU

Standard Optional
Indoor Units - FA

1. Fresh Air Intake 2. Applicable To A Variety Of Room Types


Fresh air makes indoor air healthy and comfortable. Specific ESP design can be applied to various room types
easily, like rooms with L type or U type; the air outlet can be
set separately from the indoor unit, so the air flow can be
equally distributed even the room is in irregular structure.

3. Long Distance Air Supply 4. Innovative Air Supply Technology For


High ESP makes the air supply distance up to Excellent Room Temperature Control
50m. Fall all models, return air bellow and air filter are standard
configuratio
configuration.

Fresh Air Processor Indoor Unitss

Specification-Fresh Air Processor IDU 50Hz

Model Indoor RVFA-H220/4R1A RVFA-H280/4R1A RVFA-H450/5R1A RVFA-H560/5R1A


Cooling kW 22.0 28.0 45.0 56.0
Capacity
Heating kW 24.5 31.0 49.5 61.5
Power Supply V~,Hz,Ph 220~240,50,1 220~240,50,1 380~415,50,3 380~415,50,3
Electric Data
Rated Power W 710 710 1520 1520
Air Flow Volume(Hi/Mid/Low) m3/h 2800 2800 4000 5000
Performance Noise Level(Hi/Mid/Low) dB(A) 44 45 57 59
External Static Pressure(ESP) Pa 220 220 200 200
Net(Body) mm 1755x915x645 1755x915x645 1820990855 2115990855
Dimension(WxDxH)
Packing(Body) mm 1880x940x805 1880x940x805 193510251015 222510251015
Net(Body) kg 110 110 150 225
Weight
Gross(Body) kg 130 130 170 255
Refrigerant Type R410a R410a R410a R410a
Liquid Side mm(inch) 9.52(3/8)x2 9.52(3/8)x2 12.7(1/2)x2 12.7(1/2)x2
Pipe Diameter Gas Side mm(inch) 19.05(3/4)x2 19.05(3/4)x2 22.2(7/8)x2 22.2(7/8)x2
Drainage mm DN25 DN25 DN25 DN25
Stuffing Quantity 20/40/40H unit 12/24/36 12/24/36 10/22/22 10/22/22

Notes
1.Cooling Capacity: Indoor temperature 27DB/19 WB;Outdoor temperature:35DB/24 WB.
2.Heating Capacity:Indoor temperature 20 DB;Outdoor temperature:7DB/6 WB.
3.Piping Length:Equivalent piping length:7.5m,level differernce:0m.
4.Sound level is measured at 1.4m below the air outlet.
5.The above designs and specifications are subject to change of product improvement without prior notice.

Indoor Units - FA
Connection Conditions
The following restrictions must be observed in order to maintain the indoor units connected to the same system.
When outdoor-air processing units are connected,the total connection capacity must be within 50% to 100% of that of the outdoor units.
When outdoor-air processing units are standard indoor unigs are connected,the total connection capacity of the outdoor-processing units must not exceed
30% of that of the outdoor units.
Outdoor-air processing units can be used without indoor units.


Wall-mounted IDU

LH LI

Standard Optional
Indoor Units - WM

1. Variety Panel 2. Wired Control


A variety of panel can be chosen: LH, LI and so on. Remote controller is standard, and wired controller is
optional. Wired controller can be fixed on the wall and
avoid mislaying. It's mainly used for commercial zone and
makes air conditioner control more convenient.
3. Built-in EXV
EXV inside the unit is standard.

4. 2 Ways Draining Connection 5. Several Fan Speed


Both left and right sides of unit are possible for drainage Adopt cross fan and optimization wind path design, supply
hose connection, easy for installation. air is strong and quiet.

Wall-mounted Indoor Units

Specification-Wall-mounted IDU 50Hz

Model Indoor RVWM-H022/4R1A(L) RVWM-H028/4R1A(L) RVWM-H036/4R1A(L) RVWM-H045/4R1A(L) RVWM-H056/4R1A(L) RVWM-H071/4R1A(L)


Cooling kW 2.2 2.8 3.6 4.5 5.6 7.1
Capacity
Heating kW 2.5 3.0 4.3 5.0 6.0 8.0
Power Supply V~,Hz,Ph 220~240,50,1 220~240,50,1 220~240,50,1 220~240,50,1 220~240,50,1 220~240,50,1
Electric Data
Rated Power W 38 38 38 68 68 82
Air Flow Volume(Hi/Mid/Low) m3/h 630 630 630 950 950 1200
Performance
Noise Level(Hi/Mid/Low) dB(A) 38/35/27 38/35/27 38/35/27 45/41/31 45/41/31 48
Net(Body) mm 850x300x198 850x300x198 850x300x198 970x315x235 970x315x235 1100x330x235
Dimension(WxDxH)
Packing(Body) mm 905x357x267 905x357x267 905x357x267 1010x370x300 1010x370x300 1140x385x300
Net(Body) kg 10 10 10 14 14 16
Weight
Gross(Body) kg 13 13 13 18 18 20
Refrigerant Type R410a R410a R410a R410a R410a R410a
Liquid Side mm(inch) 6.35(1/4) 6.35(1/4) 6.35(1/4) 6.35(1/4) 6.35(1/4) 9.52(3/8)
Pipe Diameter Gas Side mm(inch) 9.52(3/8) 9.52(3/8) 9.52(3/8) 12.7(1/2) 12.7(1/2) 15.88(5/8)
Drainage mm R3/4in(DN20) R3/4in(DN20) R3/4in(DN20) R3/4in(DN20) R3/4in(DN20) R3/4in(DN20)
Stuffing Quantity 20/40/40H unit 328/680/850 328/680/850 328/680/850 238/476/544 238/476/544 210/434/496

Notes
1.Cooling Capacity: Indoor temperature 27 DB/19 WB;Outdoor temperature:35 DB/24 WB.
2.Heating Capacity:Indoor temperature 20 DB;Outdoor temperature:7 DB/6WB.
3.Piping Length:Equivalent piping length:7.5m,level differernce:0m.
4.Sound level is measured 1m below the air outlet horizontally and vertically.
5.The above designs and specifications are subject to change of product improvement without prior notice.

Wall-mounted Indoor Units

Specification-Wall-mounted IDU 50Hz

Model Indoor RVWM-H022/4R1A(L) RVWM-H028/4R1A(L) RVWM-H036/4R1A(L) RVWM-H045/4R1A(L) RVWM-H056/4R1A(L) RVWM-H071/4R1A(L)


Cooling kW 2.2 2.8 3.6 4.5 5.6 7.1
Capacity
Heating kW 2.5 3.0 4.3 5.0 6.0 8.0
Power Supply V~,Hz,Ph 220~240,50,1 220~240,50,1 220~240,50,1 220~240,50,1 220~240,50,1 220~240,50,1
Electric Data
Rated Power W 38 38 38 68 68 82
Air Flow Volume(Hi/Mid/Low) m3/h 630 630 630 950 950 1200
Performance
Noise Level(Hi/Mid/Low) dB(A) 38/35/27 38/35/27 38/35/27 45/41/31 45/41/31 48
Net(Body) mm 850x300x198 850x300x198 850x300x198 970x315x235 970x315x235 1100x330x235
Dimension(WxDxH)
Packing(Body) mm 905x357x267 905x357x267 905x357x267 1010x370x300 1010x370x300 1140x385x300
Net(Body) kg 10 10 10 14 14 16
Weight
Gross(Body) kg 13 13 13 18 18 20
Refrigerant Type R410a R410a R410a R410a R410a R410a
Liquid Side mm(inch) 6.35(1/4) 6.35(1/4) 6.35(1/4) 6.35(1/4) 6.35(1/4) 9.52(3/8)
Pipe Diameter Gas Side mm(inch) 9.52(3/8) 9.52(3/8) 9.52(3/8) 12.7(1/2) 12.7(1/2) 15.88(5/8)
Drainage mm R3/4in(DN20) R3/4in(DN20) R3/4in(DN20) R3/4in(DN20) R3/4in(DN20) R3/4in(DN20)
Stuffing Quantity 20/40/40H unit 328/680/850 328/680/850 328/680/850 238/476/544 238/476/544 210/434/496

Notes
1.Cooling Capacity: Indoor temperature 27DB/19WB;Outdoor temperature:35DB/24WB.
2.Heating Capacity:Indoor temperature 20DB;Outdoor temperature:7DB/6WB.
3.Piping Length:Equivalent piping length:7.5m,level differernce:0m.
4.Sound level is measured 1m below the air outlet horizontally and vertically.
5.The above designs and specifications are subject to change of product improvement without prior notice.


Control Syetem

Wireless Network Centralized Control

Touch screen central controller Central controller

1 touch screen central controller 1 central controller can control max. 4


can control at most 512 indoor units VRF systemat most 64 indoor units

Connect to various Gateway


Control Syetem

Modbus BMS Modbus Gateway

Central control
software
1 computer can access at most 64
Bacnet BMS Bacnet Gate
Gateway
a
ARV outdoor systems, max. control
4096 indoor units.

Lonworks BMS Lonworks Gateway




Communications
adapter plate
Touch screen central controller Central controller
1 touch screen central controller 1 central controller can control max. 4 Wired controller Wired controller Remote controller
can control at most 512 indoor units VRF systemat most 64 indoor units
Communications
adapter plate
1 wired controller can control max. 16
indoor units in one group
Wired controller
Control Syetem

Central control
software
1 computer can access at most 64
)RV outdoor systems, max. control
4096 indoor units.
Communications
adapter plate
Wired controller Wired controller Remote controller


Controllers

Remote controller
Signal transmitter Signal transmitter

AUTO RUN ROOM AUTO RUN ROOM


COOL C COOL C
DRY DRY
HEAT AUTO SILE TURBO HEAT AUTO SILE TURBO
FAN SPEED FAN SPEED
HEALTH SWING
POWERCON LRSWING
HEALTH SWING
POWERCON LRSWING
DISPLAY SLEEP iFEEL
DISPLAY SLEEP iFEEL
iCLEAN Anti-F iCLEAN Anti-F
LOCK ELE.H H LOCK ELE.H H
ECO PIR ON OFF ECO PIR ON OFF

1 ON/OFF SPEED 2 1 ON/OFF MODE SPEED 2


7
8 TURBO HEALTH 9

3 10 SILENCE SLEEP 11

12 TIMER iFEEL 13

4 COOL HEAT 5 14 DISPLAY iCLEAN Anti-F 15


16
SPOT
SWING SWING 17 ELE.H ECO SWING 18
19
6
Control Syetem

YK-L
1 ON/OFF 6 Vertical Swing/Horizontal Swing 11 Sleep Function 16 Clean Function

Fan Speed Setting Mode Setting


2 7 12 Timer On/Off 17 Auxiliary Electric Heating
HIGH/MED/LOW/AUTO AUTO/COOL/DRY/HEAT/FAN

Temperature Setting
3 8 Turbo Wind 13 I Feel Function 18 Spot Swing
/Timer Range Setting

4 Cooling Mode 9 Health Function 14 LED Display On/Off 19 Economic Function

5 Heating Mode 10 Silence Function 15 Anti-fungus function

Address Setting of Indoor Unit Based on Remote Controller

With the controller off, pressing / simultaneously more than 10 seconds or more to enter address settting. This status displays only temperature and
time parameters, temperature display area shows Serial number" parameters, the range is 0-99. Time display area shows "Set value", the range is 0-255. The initial
value is 1.

By pressing / to set serial number + and -.Parameters within the serial number displays from 0 to 99 in circulation.

By pressing ECO and iCLEAN to set value number + and -.Parameters within the value number displays from 0 to 255 in circulation. After setting the two numbers,
press the MODE button to confirm sending to ODU.


Controllers

Remote Controller

Mode Setting Temperature Setting


1 8
AUTO/COOL/DRY/HEAT/FAN /Timer Range Setting

Fan Speed Setting


2 9 ON/OFF
HIGH/MED/LOW/AUTO

8
3 Vertical Swing 10 Timer On/Off
1 9

2 10
4 Feeling Function 11 Horizontal Swing

3 11

4 12
5 Strong Wind 12 Clean Function
5 13

7 14 6 Sleep Function 13 Health Function

7 LED Display ON/OFF 14 Fungusproof Function

YK-K

Wired Controller

Control Syetem

AUTO
AUT
AUTO

XK-02A XK-05A

Centralized Controller

Accessory: Centralized Controller Adaptor


Quick on/off
Set /change time
Timer Mode: a. Current/Daily Timing; b. Weekly Timer
Zone/Unit Set; Zoned Control
Centralized Control and Lock Functions
Failure Inquiry Function

Function: Centralized controller adaptor is


used with centralized controller together.

Communications
adapter plate

Touch screen central controller Wired controller Wired controller Remote controller

1 touch screen central controller


can control at most 512 indoor units

Communications
adapter plate
Control Syetem

Central controller Wired controller Wired controller Remote controller

1 central controller can control max. 4


)R< systemat most 64 indoor units

Communications
adapter plate

Wired controllere Wired controller Remote controller

Function
1). Operation status of as many as 512 indoor units can be monitored in touch screen central controller, including wind speed, set temperature, etc.
Operation status of as many as 64 indoor units can be monitored in central controller, including wind speed, set temperature, etc.
2). Mode, air speed and temperature setting are possible for individual/zoned/all indoor units.
3). 3 operation modes are available: Last-in Preferred, Centralized Control and Lock;
4). The malfunctions of the indoor units can be monitored and saved for inquiry;
5). Timed on/off is possible by specifying the exact time or by weekly schedule.
6). Any number of centralized units can be zoned with as many as 63 indoor units (central controller) & 511 indoor units (touch screen central
controller) set as one zone, so that units in the same zone will carry out the same operation. (As the factory default, a centralized group is
considered as a zone)

Centralized Controller Software

1.System overview

(USB-485 Converter)

Centralized Control
Software Adapter 1

(Group Control)

(Wired Controller)
MAX.16

(Wired Controller)

Centralized Control
Software Adapter 2

(Group Control)

MAX.16

Control Syetem
(Wired Controller)
(Wired Controller)

2.Features:
Users do not need to arrive the harsh environment of the site, they can monitor the function of units just through computer. These
greatly improve convenience of daily management and the efficiency of central air conditioners;
Timely find the fault and save the maintenance cost of air conditioner units, minimize losses ;
Timer function with multi-period week, fully automated schedule planning of unit;
Each ARV unit can access at most 63 indoor sets;
This system can access at most 64 ARV outdoor systems, it need to access repeater to increase RS485 network equipment if the outdoor
systems are more than 64.

3.Main components of Centralized Controller System
No. Main components Required

Operation system:
1 Host computer
Windows XP SP2 and above, Windows 7

Communications adapter plate


Computer and communication protocol and unit end communication protocol
2 are incompatible with each other, must add communication adapter plate to make
both communicate.

o RS-485/422
RS-232 to RS 485/422 converter
con
The centralized control system RS485 network signal conversion for RS232 serial
signal to achieve the interconnection of computers with centralized control system.

3
USB to RS-485/422 converter
The centralized control system RS485 network signal conversion for USB
to achieve the interconnection of laptops with centralized control system.

RS-485/422 Repeater Extend the communication distance and increase the number of RS-485 bus network.
4 The repeater is not required, only when there is more than 64 communications
equipment or communication distance is more than 800 meters.

4.Software introduction Main interface


Control Syetem

Area 1 -- Serial setting area, choose the serial and press Start Working button, system will in operation, press Stop Working button,
system will stop working;
Area 2 -- The inquire area for air conditioner unit, it can be divided into the system inquire and user-defined group inquire, the inquired
unit will be displayed in area 4.
Area 3 -- Display area of single air conditioner indoor unit, select one of indoor units in area 4, then the area will display the name, ID
(address of indoor unit) , system belonged ,group belonged, current condition, the room temperature of indoor unit , failure etc.
Area 4 -- Display area of air conditioner group, as shown in above picture, it displayed all the indoor units in the group System01.
Area 5 -- Control area of air conditioner, it can control one single air conditioner and some air conditioner group, this will be described in
detail later.

Billing System

1.At most 99 outdoor systems and 1024 indoor units.


2.Real-time monitor for indoor units(ON/OFF, Error);
3.Variable Control Type(Individual Control/ Air-System Control/ Group Control & Schedule);
4.The Operation History(Error, Turn on/off-time);
5.Lock the indoor units when arrear occur;
6.The PPD(Power Proportional Distribution) outputs bill by day with PDF-format report;

Software interface

Control Syetem


BMS System

The Overall Structure Of The System Shown:

Modbus

RS-485MODBUS

RS-485Device

BMS

MODBUS Gateway
MODBUS 02-63 MODBUS
Gateway01 Gateway64

System1 System64

IU1-1 IU1-2 IU1-49 IU1-50 IU64


IU
IU6
U64-1 IU64-2 IU64-49 IU64-50
Control Syetem

Lonworks

Ethernet

BMS

Power system
Fire protection system

Lighting system Elevator system Monitor system




Wireless Network Control System

&OLPD8QR

A-link Wireless Router

iphone6

Remote Mode
Cloud
Server

iphone6

&OLPD8QR

A-lin Wireless Router

iphone6
Home Mode

Features:
1.
air conditionercan connect to intelligent terminal through WIFI or GPRS network,customers can enjoy fun and convenience of
remote control the AC via iphone, ipad and other mobile terminals(Android and IOS) to control the AC at anytime and anywhere.
2.Thefunction of software on Mobile terminal includes mode control,temperature control, swing control, timing control.
3.Customers can set schedule to plan their day, also the scene mode can be set conveniently.

China
Chi
Chin
Ch
C h in
n a Mo
Mobile
M ob
bil e
bile China Mobile
China Mobile China Mobile

Control Syetem


Monitoring Software

Self-diagnosis software can be used as remote controller, it is recommended for commissioning. It can monitor the running state of the
outdoor and indoor units real time. And display the malfunctions, be convenient to do the commissioning and trouble-shooting work.
Control Syetem


Selection Software

To meet the customers' requirements, )ROSG;TU has developed the advanced selection software. The software provides quick and convenient
selectable options for users, supports multiple languages, greatly improves the selection and installation process.

6 Parts Of The )RV Selection

No. Steps Instruction

1 Selecting indoor units Selecting indoor unit for project according the capacity, air flow volume and room information

Automatic selection suitable outdoor unit for project according to the capacity of indoor units,
2 Selecting outdoor units
the capacity ratio between indoor and outdoor unit, and the temperature of indoor and outdoor unit.

Every outdoor system can draw corresponding piping diagram. The system will auto select branch pipe,
3 Drawing piping diagram gas pipe and liquid pipe according to selected indoor and outdoor unit. The pipe length can be input
according to the project diagram if the project need. Ability compensation also can be displayed for the software.

Every outdoor system can draw wiring diagram. The wiring length can be input according to the project diagram
4 Drawing wiring diagram if the project need. Wring includes: power cable, signal cable and so on. Remote controller and wired controller
can be chosen according to the customer's demands.

Selecting BMS or The software can be used to select either BMS or centralized controller and draw connecting wiring diagram.
5 Centralized Controller

6 Output the report The report can be output in 3 kinds of forms, PDF, word and CAD.

The Result As Below:


ClimaUno Project Express V1.0.4

Control Syetem


Branch Joints

)FG-00A )FG-12A
Gas side joint Gas side joint

Liquid side joint Liquid side joint


Branch Joints


)FG-24A )FG-34A
Gas side joint Gas side joint

Liquid side joint Liquid side joint

Branch Joints


)FG-50A )FG-64A
Gas side joint Gas side joint

Liquid side joint Liquid side joint


Branch Joints


).8<Heat Recovery Ventilator

Nomenclature

 HRV - 200 / 4

Power Supply
4:220-240V~, 1Ph, 50Hz
5:380-415V~, 3Ph, 50Hz
Air Flow Volum( m 3/h)

Heat Recovery Ventilator


Recovery Ventilator

h
HRV-Heat


Features
1. HRV (Heat Recovery Ventilator) Adopt High Efficiency Heat Exchanged Core.
The heat exchanged core forming by special paper that be processed with chemical treatment, which could create the optimum result in temperature, humidity and
cooling recovery.

2. Energy Saving
Fresh air and exhaust air are crossed through the heat exchanger.
Temperature and humidity exchange happened in the heat recovery ventilator.
Fresh-air can get a great deal of energy from exhaust air.

3. Adopt Centrifugal Fan With Lower Power Consumption And Longer Air Supply Distance; Easy Control,
Friendly Operation.
Fresh air and exhaust air are crossed through the heat exchanger.
Temperature and humidity exchange happened in the heat recovery ventilator.
Fresh-air can get a great deal of energy from exhaust air.

Output of dirty air Output of fresh air

Air-to-air heating exchanger

Indoor
Outdoor

Input of fresh air Input of dirty air

4. High Efficiency 5. Low Noise


Adopt high quality paper-core heat exchanger, less air resistance. Adopt sound absorption material, quiet operation.
Fresh-air can get a great deal of energy from exhaust air.

6. Different Modes For Your Choice


Exhausting mode (Hi/Mid/Low fan speed can be chosen)
Air supply mode (Hi/Mid/Low fan speed can be chosen)
By pass mode (Hi/Mid/Low fan speed can be chosen)
In this mode, there is no heat exchanging happened, which is more energy saving.
For example:
Recovery Ventilator
HRV-Heat

If outdoor temperature is lower than indoor, we don't need heat exchanging, but we need fresh air. We can choose by pass mode.
Remark: this mode is only available for HRV-200~1000.
Heat exchanging mode (Hi/Mid/Low fan speed can be chosen)
In this mode, supply air flow=exhaust air flow.
Auto mode
In this mode, the unit will run at heat exchange mode or by pass mode judged by outdoor temperature and indoor temperature with
low speed air flow.

7. Compact Design, Easily Installation & Maintenance.




Heat Recovery Ventilator

Specification-HRV

Model Indoor  RV-200/4 HRV-300/4 HRV-400/4 HRV-500/4 HRV-600/4 HRV-800/4 HRV-1000/4


m3/h 200 300 400 500 600 800 1000
Volume
CFM 118 176 235 294 353 471 588
External Static Pressure Pa 75 75 100 110 110 120 120
Power Supply V~,Hz,Ph 220~240,50,1 220~240,50,1 220~240,50,1 220~240,50,1 220~240,50,1 220~240,50,1 220~240,50,1
Electric Data
Power Input W 65 130 200 220 220 410 510
Cooling Temp. Efficiency % 62 63 61 60 63 63 62
Enthalpy Efficiency % 56 56 56 54 55 54 52
Temp. Efficiency % 72 71.5 71 70 72 71 71
Heating
Enthalpy Efficiency % 58 56 56 56 62 62 62
Noise Level dB(A) 34 34.8 36 36 37.5 38.5 41.5
Net Dimension(WxDxH) mm 660x580x264 744x599x270 744x804x270 828x904x264 824x904x270 1116x884x388 1116x1134x388
Flange mm 144 144 144 194 194 243 243
Net Weight kg 23 27 33 46 48 63 79
Stuffing Quantity unit 280/568/710 216/456/513 168/344/387 112/244/280 112/224/252 72/156/156 60/120/120

Specification-HRV

Model Indoor HRV-1500/5 HRV-2000/5 HRV-2500/5 HRV-3000/5 HRV-4000/5 HRV-5000/5


m3/h 1500 2000 2500 3000 4000 5000
Volume
CFM 882 1176 1471 1765 2353 2941
External Static Pressure Pa 160 170 180 200 220 240
Power Supply V~,Hz,Ph 380~415,50,3 380~415,50,3 380~415,50,3 380~415,50,3 380~415,50,3 380~415,50,3
Electric Data
Power Input W 1000 1200 2000 2100 2400 3000
Cooling Temp. Efficiency % 62 60 62 64 64 64
Enthalpy Efficiency % 51 52 50 55 51 55
Temp. Efficiency % 70.5 70 70 72 71 72
Heating
Enthalpy Efficiency % 62 63 63 64 64 65
Noise Level dB(A) 51 53 55 57 64 64
Net Dimension(WxDxH) mm 1500x1200x540 1500x1200x540 1500x1200x540 1500x1200x540 1620x1330x990 1620x1330x990
Flange mm 320x300 320x300 320x300 320x300 323x253 500x690
Net Weight kg 173 186 200 270 300 320
Stuffing Quantity unit 16/36/36 16/36/36 16/36/36 16/36/36 8/16/16 8/16/16
Recovery Ventilator
HRV-Heat

You might also like