Orca Share Media Q&A
Orca Share Media Q&A
This will test your knowledge about the concepts embodying different branches of Science. Choose the best answer
among the options provided after each question.
4. Magma reaches the earth's surface through crustal fissures called what?
a. volcano
b. fault
c. cone
d. lava
e. None of the above
6. What do you call the measuring instrument used in determining the location and origin of waves caused by the
internal vibration occurrence of the earth?
a. Seismograph
b. Radar
c. Satellite
d. RayleighWave Meter
e. None of the above
7. The instrument mentioned in the previous item measures what particular wave?
a. electromagnetic waves
b. sound waves
c. radio waves
d. seismic waves
e. None of the above
13. What is true about the electronegativity of the elements across the Periodic Table?
a. Increasing from top to bottom, decreasing from left to right.
b. Decreasing from top to bottom, increasing from left to right.
c. Both increasing from top to bottom and from left to right.
d. Both decreasing from top to bottom and from left to right.
e. None of the above
14. What is true about the electron affinity of the elements across the Periodic Table?
a. Increasing from top to bottom, decreasing from left to right.
b. Decreasing from top to bottom, increasing from left to right.
c. Both increasing from top to bottom and from left to right.
d. Both decreasing from top to bottom and from left to right.
e. None of the above
15. What elements were discovered by Marie Curie and Piere Curie?
a. Radium and Magnesium
b. Radium and Strontium
c. Radium and Polonium
d. Radium and Aluminum
e. None of the above
16. How much time would it take a car to travel 300 meters if its velocity is 30 m/s?
a. 5 s
b. 10 s
c. 20 s
d. 12 s
e. None of the above
17. An express delivery truck driver needs to reach its destination which is 450 km away from his point. How long
would it take him to reach it considering that his velocity is 90 kph?
a. 7 hours
b. 3.5 hours
c. 9 hours
d. 5 hours
e. None of the above
18. Is it possible to have a distance in the value of zero but at the same have a displacement in a non-zero value?
a. Yes. It can always happen.
b. Yes. It sometimes happens.
c. No. Both must be non-zero.
d. No. But reasons are unknown.
e. None of the above
19. A vessel has a velocity of 15 mi/hr. How far would it travel after a day?
a. 330 miles
b. 340 miles
c. 350 miles
d. 360 miles
e. None of the above
20. Aside from the final velocity an the time, what must also be included to determine the acceleration of an object?
a. distance travelled
b. instantaneous velocity
c. initial velocity
d. range
e. None of the above
21. What type of acceleration does a free-falling body have as it goes down?
a. decreasing
b. increasing
c. constant
d. uniformly accelerating
e. None of the above
b.
|________
|/
|/
|/______________
c.
|
|
|_____________
|_____________
24. Unless acted by an external force, a moving object will continue moving and an object at rest will remain at rest, is
a statement of what?
a. Law of Acceleration
b. Law of Inertia
c. Law of Interaction
c. Second Law of Thermodynamics
25. Moving along the same path, which among these vehicles would have the greatest acceleration?
I. Car
II. Jeepney
III. Bus
IV. Truck
a. I only
b. II only
c. III only
d. IV only
e. None of the above
27. An object which started at rest now speeds up with an acceleration of 35 mi/hr. What is its initial velocity?
a. -35 mi/hr
b. 35 mi/hr
c. 0 mi/hr
d. Cannot be determined.
e. None of the above
28. What is the measure of gravitational pull of the earth observed in the acceleration of an object thrown upward
through an applied force?
a. -6.43 x 10^23
b. 6.43 x 10^23
c. 9.8 m/s^2
d. -9.8 m/s^2
e. None of the above
30. Both the parents have straight hair. Is it possible for them to have an offspring who has a curly hair?
a. No. They must both have a curly hair, too.
b. No. At least one of them must have curly hair, too.
c. Yes, If their genes are heterozygous.
d. Yes, If their genes are homozygous.
e. None of the above
39. These are the vector sum of all the forces acting on an object.
a. Net Weight
b. Total Force
c. Total Force Sum
d. Net Force
e. None of the above
40. These are basic measureable quantities that have no connection with each other.
a. Fundamental Forces
b. Fundamental Measures
c. Fundamental Quantities
d. Fundamental Compositions
e. None of the above
MATH PROBLEMS
1. Mark is two years older than Joel. At present time, Mark is twice as old as Joel and after four years, he will be
eight years old. How old will Joel be after 10 years?
a. 11
b. 10
c. 12
d. 14
e. 8
2. It takes two months to finish a two-storey building done by 100 workers. How much time will it consume if the
number of workers was increased to 120?
a. 38 days
b. 40 days
c. 28 days
d. 48 days
e. 50 days
3. In a contest, within 30 minutes, Kristina has baked14 pieces of pastries. How many pastries will she be able to
bake if the time is shortened to 10 minutes?
a. Approx. 4
b. Approx. 5
c. Approx. 7
d. Approx. 8
e. Approx. 6
4. A car leaves the terminal at 9:30 A.M. with a speed of 60 kph. At what time will it have a total covered distance
of 120 kilometers?
a. 9:45 A.M.
b. 10:45 A.M.
c. 10:30 A.M.
d. 11:30 A.M.
e. 12:00 NN
5. Arthur has travelled a certain distance after an hour. He has a particular speed of 10 kph. How far was the
distance covered?
a. 6 km
b. 8 km
c. 5 km
d. 12 km
e. 10 km
7. The present time is 2:45 P.M. What is the time 6 hours and 22 minutes ago?
a. 8:22 A.M
b. 8:23 A.M.
c. 8:24 A.M.
d. 8:25 A.M.
e. 8:26 A.M.
8. How much time has passed if it already 2:15 A.M. at the present time? Note that the counting started from 7:38
A.M.
a. 18 hrs, 37 mins
b. 17 hrs, 37 mins
c. 16 hrs, 37 mins
d. 17 hrs, 27 mins
e. 18 hrs, 27 mins
9. How many hours are 5400 mins?
a. 20
b. 50
c. 80
d. 75
e. 90
10. Boys and girls are in the ratio of 10:2. If there are 236 girls in the area, how many are the boys?
a. 1160
b. 1170
c. 1180
d. 1190
e. 2000
11. In a survey, respondents, according to gender, were selected in a ratio of 2:4 considering female to male order.
If 48 females were chosen, how many males were selected?
a. 76
b. 96
c. 86
d. 106
e. 126
12. Product A is twice the price of Product B. Their sum is $46. Represent the problem in an equation.
a. 2x + x = 46
b. 2x + x= 47x
c. x + x= 47
d. x + 2x= 46
e. x + 26 + 46= 0
13. Ren has Php. 200.00. He has to buy 2 notebooks at Php. 22.00 each, a pen for Php. 13.00 and 3 pads of paper
at Php. 15.00 each. Represent Ren's change in an equation.
a. 200-(2x+z)=y
b. 200+(2x+z)=y
c. 200+(2x+y+z)=c
d. 200-(2x+y+z)=c
e. 200-(2x+y+3z)=c
14. What is the probability of getting an ace from a normal deck of cards?
a. 1/50
b. 1/52
c. 1/14
d. 1/13
e. 1/10
15. What is the probability of drawing red cards from a normal deck of cards?
a. 1/4
b. 1/13
c. 1/2
d. 1/5
e. 2/5
19. There are 5 pairs of shirts and trousers. If there are 3 designs for the shirts and 4 designs for the trousers, how
many unique pairs are possible to be combined?
a. 30
b. 40
c. 45
d. 50
e. 55
20. Tina has an average of 99 for her 8 subjects. What must be her 9th subject's grade in order for her to maintain
her average?
a. 97
b. 99
c. 96
d. 93
e. 95
(21-24) Refer to the choices below. Choose what conic section is being represented by each equation.
a. circle
b. ellipse
c. hyperbola
d. parabola
2 2
x y
21. 2 − 2 =1
a b
x2 y 2
22. + =1
a2 b 2
∑3i
i=5
a. 33
b. 38
c. 35
d. 39
e. 36
26. Shyna borrowed Php. 35, 000.00 with an annual interest of 6%. How much would be the interest?
a. Php. 2, 100.00
b. Php. 2, 200.00
c. Php. 3, 500.00
d. Php. 2, 000.00
e. Php. 1, 280.00
27. Lance borrowed an amount with a 5% interest. After a year, Lance returned a total amount of Php. 2, 500,
000.00 which already includes the annual interest. How much is the principal amount?
a. Php. 2, 375, 000.00
b. Php. 2, 300, 000.00
c. Php. 1, 375, 000.00
d. Php. 2, 000, 000.00
e. Php. 2, 400,000.00
28. Grace bought 4 loaves of bread for Php. 250.00. How much is a single loaf?
a. Php. 60.50
b. Php. 61.50
c. Php. 62.50
d. Php. 63.50
e. Php. 70.00
29. If three dozens of eggs cost Php. 167.00, how much does half a dozen cost?
a. Php. 25.00
b. Php. 27.83
c. Php. 27.67
d. Php. 25.81
e. Php. 26.82
30. In a triangle ACE, if BD is the midpoint which measures 11.25, what will be the measure of AE? AC
measures shorter than CE. Note that AE is twice the measure of the triangle's midpoint.
a. 22.5
b. 23.5
c. 11.25
d. 12.25
e. 23.50
31. If Junior was 16 years old five years ago, how old will he be seven years from now?
a. 24
b. 25
c. 26
d. 27
e. 28
32. Ian and Debbs are twins. Ian was sent to outer space for planetary exploration. How old will Ian be after ten
years of not meeting Debbs?
a. Half the age of Debbs.
b. Ten years younger than Debbs.
c. Ten years older than Debbs.
d. Same as Debbs.
e. No sufficient data.
33. Half a dozen of donuts cost Php. 430.00. Mark bought 3/4 of a dozen and paid Php. 700.00. How much will
his change be?
a. Php. 25.00
b. Php. 35.00
c. Php. 45.00
d. Php. 55.00
e. Php. 65.00
34. It took Mary 12 days to finish stitching the arts. How many days would it take if Lance would offer help and
do the same work as hers?
a. 4 days
b. 5 days
c. 6 days
d. 7 days
e. 8 days
1
35. Lenie has a whole pie and gave to her friend, Tina. Tina told her friend Gayle that the pie is tasty so the
8
1
latter asked for another . Lenie’s mother has been appreciative with Tina’s compliment and told Lenie to give
8
1
Tina another . How much was left to Lenie?
5
9
a.
21
21
b.
8
11
c.
8
8
d.
21
9
e.
20
36. How many minutes can Rey travel 25 miles if it took him 2 hours to cover a distance of 12 miles?
a. 230minutes
b. 240 minutes
c. 255 minutes
d. 250 minutes
e. 300 minutes
37. A step of a stair measures one third of a foot. How many steps are needed to reach the second floor which is 6
feet from the ground?
a. At least 18 steps
b. At least 20 steps
c. At least 12 steps
d. At least 22 steps
e. At least 14 steps
38. Find the measurement of the width which measures x+21 on the right and 4x-50 on the left.
a. 22
b. 21
c. 18
d. 20
e. 24
40. How much does a kilo of grapes cost if three and a half kilo cost Php. 784.00?
a. Php. 221.00
b. Php. 224.00
c. Php. 225.00
d. Php. 226.00
e. Php. 230.00
ENGLISH, VOCABULARY, ORAL COMMUNICATION and TECHNICAL WRITING
I.English Vocabulary
Find the opposite term for the following words:
1. SALUTARY
a. beneficial
b. sickening
c. aiding
d. healthful
e. None of the above
2. CAJOLE
a. repulse
b. persuade
c. seduce
d. entrap
e. None of the above
3. PUERILE
a. callow
b. babyish
c. mature
d. infantile
e. None of the above
4. QUINTESSENTIAL
a. byword
b. epitome
c. model
d. unideal
e. None of the above
5. TERSE
a. brief
b. diffuse
c. compact
d. curt
e. None of the above
6. BRACKISH
a. delectable
b. unsavoury
c. yucky
d. distasteful
e. None of the above
Find the similar term for the following words:
7. MURMUR
a. muttering
b. voiceless
c. quiet
d. silent
e. None of the above
8. RHAPSODIC
a. sad
b. blue
c. intensely emotional
d. joyful
e. None of the above
9. FELICITY
a. misery
b. depression
c. despair
d. ecstasy
e. None of the above
10. QUIESCENT
a. alive
b. functional
c. lethargic
d. working
e. None of the above
12. The country __________ the Earth Day movement last April 22, 2018.
a. joins
b. joined
c. will join
d. will be joining
e. None of the above
13. The student teachers ____________ demo teaching tomorrow morning.
a. conducted
b. have conducted
c. to conduct
d. will conduct
e. None of the above
17. She will not come to the party for she does not feel _______.
a. good
b. well
c. fine
d. better
e. None of the above
20. According to aquaculture technologists, what has been used to determine the creature found?
a. its teeth
b. its skin
c. its tail
d. its hair strands found inside its body
e. None of the above
22. What have been washed away with the carcass in New Zealand?
a. logs
b. plywoods
c. drift woods
d. trimmed grasses
e. None of the above
27. The cockatoos are roaming around the island for what purpose?
a. To see the scenic view.
b. To quench their thirst
c. To forage for food
d. To look for their relatives
e. To visit Marcelo
28. How many years have Marcelo been doing her job?
a. 13 years
b. 17 years
c. 20 years
d. 30 years
e. 32 years
36. In this type of speech, the speaker is given at least few minutes to prepare after being given the topic. What do you
call this speech?
a. Manuscript
b. Impromptu
c. Extemporaneous
d. Practiced Speech
e. None of the above
39. In Maritime field, in what aspect has Oral Communication become most beneficial?
a. Use of jargon
b. Use of non-verbal cues
c. Intercultural communication
d. Effective communicating strategies
e. None of the above
V. Technical Writing
48. It is a written plan of a proposed project which the sender has observed in the community.
a. Project Proposal
b. Plan Proposal
c. Agreement Proposal
d. Business Proposal
e. None of the Above
49. It combines different ideas and details gotten in the text read.
a. synthesis
b. summary
c. paraphrased information
d. quotation
e. None of the above
5lb ? 30lb
MECHANICAL IQ
1.
5ft 10ft
To balance the bar, how much weight should be placed on the right side?
A. 5lb C. 1lb
B. 10lb ? D. 2.5lb 12lb
2.
How much weight on block A do you need to balance the bar below?
A. 30lb C. 20lb
B. 15lb D. 25lb
4. If the block #1 is moved 10ft to the right, how far up is block #2 lifted?
Consider the illustration below.
A. 10ft
B. 20ft
C. 30ft
D. 40ft
5.
A B
A. Ball A
B. Ball B
C. Both balls
D. Not enough data
A. 2
B. 3
C. 4
D. 5
8.
A B
Water enters on the pipe at a constant rate, where is the velocity of the water highest?
A. A
B. B
C. Equal
D. Not enough data
9.
B
A
If the pulley A rotates, how much torque will be produced by pulley B?
A. Low
B. High
C. Same as the Pulley A
D. None of the above
10. C B
A. A
B. B.
C. C.
D. D.
11.
A B
If block B moves 10 feet to the right, how far will the block A move?
A. 5ft
B. 10ft
C. 15ft
D. 20ft
A. wall
B. foundation
C. roof
D. door
3. What is the sum of the first 25 terms of the sequence 4, 9, 14, 19, 24...
a. 1599
b. 1699
c. 1500
d. 1600
e. 1799
5. What is the 1st term in the sequence if the second term is 24 and the 5th term is 3?
a. 31
b. 35
c. 33
d. 34
e. 36
6. What are the 4th and 5th terms in the geometric sequence 3, 12, 48...?
a. 193, 768
b. 192, 767
c. 192, 768
d. 193, 769
e. 192, 766
7. What are the 2nd, 3rd and 4th terms in the geometric sequence 1, ____, ____, _____, 64, 256?
a. 1, 15, 16
b. 1, 14, 16
c. 2, 15, 17
d. 1, 16, 17
e. 2, 14, 16
8. In the sequence (geometric), what three terms,follow these term: 120, 60, 30...?
a. 15, 15/4, 15/6
b. 15, 15/4, 13
c. 15, 15/7, 15/8
d. 15, 15/3, 14
e. 15, 15/2, 15/4
9. In the sequence 5, ____, 20, 40, ____, ____. What are the missing terms?
a. 10, 80, 170
b. 10, 80, 160
c. 10, 70, 160
d. 10, 60, 160
e. 10, 50, 160
10. What is the sum of the first five terms of the sequence 3, 6, 12, 24, 48, 96?
a. 93
b. 94
c. 95
d. 83
e. 96
11. What is the common difference in the sequence 30, 36, 42, 48, 54, 60?
a. 4
b. 6
c. 12
d. 18
e. 24
12. What is the common difference in the sequence 21, 42, 63, 84, 105?
a. 21
b. 22
c. 23
d. 24
e. 25
13. What is the common ration in this geometric sequence: 14, 70, 350,1750, 8750?
a. 15
b. 5
c. 10
d. 12
e. 15
14. 5, 10, 20, 40, 80, 160 has what common ratio?
a. 2
b. 4
c. 5
d. 7
e. 10
15. If Line AB is parallel to Line CD and their midpoint is Line EF. What is the value of Line EF?
9cm
A B
E F
C D
15cm
a. 10 cm
b. 12 cm
c. 14 cm
d. 16 cm
e. 8cm
16. If Line WX is congruent to Line YZ and Line WZ is congruent to Line XY. What is the value of Line WZ?
X
25 cm 20 cm
X Y
Z
a. 20 cm
b. 25 cm
c. 30 cm
d. 15 cm
e. 10 cm
17. A triangle has a perimeter of 50. If two of its sides are equal, what is the value of the third side? Express answer in
centimeter?
X X
X+5
a. 20 cm
b. 25 cm
c. 30 cm
d. 15 cm
e. 200 cm
18. A certain rectangle has a perimeter of 50m and a length of 14 meters. What is its width?
14cm
a. 10 cm
b. 11 cm
c. 12 cm
d. 13 cm
e. 14 cm
19. If Line QR=100 m and Line SR=400 m, then what is the value of Line QS?
Q
100 m
S
R
400 m
a. 412.3 m
b. 423.1 m
c. 421.3 m
d. 431.1 m
e. 411.2 m
20. What is the next term in the Fibonacci sequence 1, 1, 2, 3, 5, 8...?
a.12
b. 13
c. 14
d. 16
e. 21
21. What is the second term in the Fibonacci sequence 2, ____, 5, 8, 13, 21...?
a. 0
b. 2
c. 1
d. 3
e. 5
23. The mean of the values 2, 21, 47, 68, 87,76 is?
a. 50.16
b. 50.17
c. 50.18
d. 50.19
e. 50.20
25. What will complete the measures of central tendency? Mean, Median...
a. variance
b. lower limits
c. mode
d. standard deviation
e. scores
29. The branch of Mathematics that deals with the gathering, tabulation of data.
a. Pre- Calculus
b. Algebra
c. General Mathematics
d. Statistics
e. Trigonometry
x +1
30. What is the limit of lim ?
x−8 x−8
a. 1
b. 7
c. 8
d. 9
e. 6
35. What is the value of f(x) in the function f ( x )=3 x 2−3 where f (5)?
a. 72
b. 70
c. 74
d. 75
d. 81
36. Refer to the figure below:
15x-38
2x+38
x+40
6x-2
J
a. 7
b. 15
c. 8
d. 16
e. 17
NON-VERBAL REASONING
1. Flight attendants told the passengers to fasten their seatbelts so they will be safe. All the passenger have had a safe
trip.
a. One of the passengers did not follow instruction.
b. None of them followed.
c. The attendants went angry.
d. All passengers fastened their seatbelts.
e. Not of the above
2. I'll just watch some movies at home if my sister will not join the victory party. Thankfully, I do not have to stay at
home and watch movies alone.
a. My sister joined the party.
b. My sister joined me in watching the movie.
c. The victory party was cancelled.
d. The victory party was held in our home.
e. None of the above
3. You will gain a scholarship grant if you join the fun run. You were not granted the scholarship.
a. The fun run was postponed.
b. The fun run is a scam.
c. You did not join the fun run.
d. You joined the fun run and enjoyed it.
e. None of the above.
4. Your payment must be more than Php. 1000.00 to comply to your previous debts. You were given a receipt saying
that your previous debts were already paid.
a. Your payment was not enough.
b. The receipt is a bluff.
c. You paid more than a thousand.
d. You were also given a change.
e. None of the above
5. If you skip classes today, you will miss three of the scheduled examinations. Your parents are summoned to the
dean's office for some tests you missed.
a. You skipped classes today.
b. You took only two examinations today.
c. Your parents are busy.
d. You skipped classes today but the examinations were postponed.
e. None of the above
6. The student researchers must get 90 to be included in the final's top learners. They were given only the passing
grade.
a. They will not graduate.
b. They will not be included on the top list.
c. They will re-defend their research.
d. They will move to another school.
e. None of the above.
7. You must watch the news to be able to report something informative tomorrow. You were not able to report
something informative tomorrow.
a. You did not watch the news.
b. You watched the news.
c. The teacher told you to report some other things.
d. News is not your forte.
e. None of the above
8. My friends in nursing department already have their own cars. The parking area has upper and lower portion.
People said that most of the cars in upper parking lot are owned by nurses.
a. The cars are owned by my friends.
b. The cars are luxurious and expensive
c. The cars in lower parking space do not belong to nursing students.
d. Others cannot park in the parking area due to congestion.
e. None of te above
9. The government mus focus on programs regarding natural resources to achieve progress. Progress is seen in the
country.
a. The government disregarded the suggetion.
b. The bashers will not post anything on social media about the programs.
c. The government focused on natural resources.
d. The government found some alternative programs.
e. None of the above
10. People in the area must focus on the alarm system. The alarm would be rung twice to tell the people to go to
hugherplaces; three times to prepare for evacuation; and four times for them to completely evacuate their shelters.
The alarm rung once.
a. The alarm might be on dry run.
b. The people would be confused on what to do.
c. The people may have not just heard the alarm right.
d. The people would guess the possible indication of the alarm.
e. None of the above
11. One of the cues that the mass is about to start is when people started becoming silent on their seats. The people
keep on talking to each other.
a. The people do not know that the mass has started already.
b. The mass will never start this early.
c. The mass is not about to start yet.
d. The conductor of the mass wore a different attire thus, he was not recognized.
e. None of the above
12. During an inquisition, the suspect was asked to choose between telling the truth and being saved or staying silent
and being executed. A public execution was held the next day.
a. He told the truth.
b. He chose to be silent.
c. He really wanted to die.
d. He was saved.
e. None of the above
13. A sign says 'Do not step on this area, slippery'. My friend slipped after a minute.
a. She stepped on the area with the sign.
b. She lose her balance.
c. She forgot that she has read the sign.
d. She would not go there again.
e. None of the above
14. The mall will open at 9:00 in the morning. It took me and my sister an hour due to heavy traffic and when I looked
at my watch, it's already 9:15 a.m.
a. The mall is not open yet.
b. The mall is about to close.
c. We are just in good timing.
d. The mall will never be open due to bankruptcy.
e. None of the above
15. It would take an hour to travel through a tricycle and half an hour through bus. I only have 15 minutes before
being marked as 'late' for my first subject.
a. I would rather take a tricycle.
b. I would insist a ride in a bus.
c. Any of the two won't save me from being late.
d. I would not go any longer.
e. None of the above
16. One of the rules our instructor told us is not to look back during examination or we will get zero whatever the
reason may be. One of my friends screamed while taking the examination.
a. Everyone looked back and everyone got zero.
b. No one looked back thus, no one was given a zero.
c. My friend was given zero for causing a commotion.
d. The whole class was dismissed.
e. None of the above.
17. I met my group today so we'll have a good plan for our presentation tomorrow. The presentation end up as messed
up as how I imagined it would be.
a. The group was not able to come up with a good plan.
b. The teacher's standards were just too high.
c. The group fought over about the presentation.
d. The group did not have a leader.
e. None of the above
18. Teachers must use visual aids for effective classroom learning to happen. The class got bored.
a. The teacher did not attend the class.
b. The teacher was lazy.
c. The teacher did not use visual aids.
d. The visual aids were lost.
e. None of the above
19. The cancellation of scheduled flights today will depend on the weather system. The flights were cancelled.
a. The weather is good.
b. The pilot and flight attendants can't come to work.
c. The weather is not good at all.
d. The weather was good however, the airplane is under repair and maintenance.
e. None of the above
20. My father advised the chef to cook more for more visitors are coming. The visitors were all fed.
a. The chef did not hear my father.
b. The chef is responsible.
c. The chef cooked more and enough food as what my father told him.
d. The chef is disobedient.
e. None of the above
MENTAL TOUGHNESS
1.Do you easily get carried away with flowery words from politicians? (Nadadala ka basamgamabubulaklaknasalita ng
mgapolitiko?)
2. Have you raised your voice while talking to your parents? (Napapagtaasanmoba ng boses ang iyongmagulang?)
3. Have you killed someone due to extreme hatred and madness? (Naranasanmona bang pumataydahilsasobranggalit o
inis
5. Do you usually cry when someone bullies you? (Umiiyak ka bakapagika'ynatutukso o inaasar?)
7. Do you feel bad about people who are throwing their trashes anywhere? (Nagagalit ka basamgataongnagtatapon ng
basura kung saan?)
9. Do you easily feel resentment when your colleague did not include you in their trips?
10. Does your crush thrill you wen you see him or her? (Napapakilig ka ba ng crush mokapagnakikitamosya?)
11. Can a comedian mak you laugh easily? (Mabilis ka bamapatawa ng isangkomedyante?)
12. Do you get excited when you have an incoming trip with your colleague? (Nasasabik ka basatuwing may
daratingkayong gala ng mgakaibiganmo?)
14. Do you become shy once told to show your talent? (Nahihiya ka bang ipakita ang iyongtalento?)
15. Do you feel some resentment when no one pays you attention in your house? (Nagtatampo ka basatuwinghindi ka
napapansinsainyongtahanan?)
16. Are you entertained with the things you are reading? (Naaaliw ka basamgababasahinnaiyongnababasa?)
17. Do you prefer being alone instead of being with other people? (Mas gusto mobanamapag-isanalamangkaysa may
mgakasama?)
18. Have you tried hurting yourself through blades or other ways? (Nasubukanmona bang maglaslas o saktang ang
iyongsarili?)
19. Have you hurt your parents physically? (Napagbuhatanmonaba ng kamay ang iyongmgamagulang?)
20. Do you usually curse when you are with your colleague? (Madalas ka bang magmurasaharap ng iyongmgatropa?)
21. Have you experienced using illegal drugs? (Nakaranas ka na bang gumamit ng ipinagbabawalnagamot?)
22. Do you usually drink alcohol when you encounter a problem? (Umiinom ka ba ng alaksatuwingika'y may
problema?)
26. Are you a war freak when you were a kid? (Mapang-away ka banoongika'ybata pa?)
28. When somebody fell into the ground do laught at them? (Pinagtatawananmoba ang
isangtaokapagnakitamongnadapaito?)
29. Whenever there is a serious thing or issue, are you taking it seriously? (Nagigingseryoso ka
basamgaseryosongbagay?)
30. Do you felt bad when someone say to you that you are gay? (Napipikon ka bapagsinasabihangbakla o bading?)
31. Do you blame yourself when something went wrong? (Sinisisimoba ang
iyongsarilikapagnagkakamalisaisangbagay?)
32. Do you behave properly when you are in someone's house? (Disiplinado ka bakapagnasaibangtahanan?)
33. Have you eve experience killing someon with no any reasons?
(Naranasnmonabangmakapataysawalangkadahilanangbagay?)
34.Are you a fond of solvin math problems?(Mahilig ka bang mag-solve ng math problems?)
37. Have you ever join to any illegal activities such as gang war, hazing, etc.? (Mahilig ka basa away?)
38. Do you always fight for what you believe when you are talking to such topic or issues that you are aware of?
(Kapagnakikipag-usap ka, madalasbaitongmauwisaisang debate?)
39. Do you easily find a solution to any hard solution in your life? (Mahusay ka bang umisip ng
solusyonsaisangmahirapnasitwasyon?)
40. Do you easily make a decision even if you are on the verge of any hard situatuon?(Nakakapag-isip ka ba ng
ayoskapagnasaalanganingsitwasyon ka?)
41. Do you experience such argument with your parents on a certain issue? (Nakipagargumento ka
nabasaiyongnanay?)
42. Do you ever fight for your right in the fare policy that was being implemented right now? (Nakipagtalo ka
nabasakonduktor ng bus?)
43. Do you attempt to question the contents of the bible? (Nasubukanmona bang kwestyunin ang isanglibro(biblia)?
44. Have you fought with a vendor in the market? Nakipagtalo ka nabasatinderasapalengke?
45. When you are making a decision, do you consider any people that will be affected in doing it? (Nasubukanmona
bang tumaliwassaninanais ng nakakaramiupangmanindigansa tama?)
46. Did you curse inside the church becuase you had been carried out into such situation? (Nagmura ka nabasaloob ng
simbahansakadahilanangika'ynagulat?)
47. Have you already involved to a gang war in your town? ( Nakipag away ka nabasamgadayosainyonglugar?)
49. Have you reached the point of life when you want to go to a place when there is no people except you? (Dumating
ka nabasa punto ng buhayna kung saan gusto mo ng magpakalayolayo at mapagisa?)
50. Do you ever think to drop out in the school? (Naisipmona bang humintosapagaaral?)
51. Do you ever forced by someone in choosing your career path? (Napipilitan ka langba kaya mokinuha ang
kursongtinatahakmo?)
52. Do you prefer to smile instead of explaining to somebody that you are sad? (Mas pinipilimo bang
ngumitikahithindimonanagugustuhan ang mgabagaysapaligidmo?)
53. Have you experienced being involved to a fight in phone conversation? ( Nakikipagtalo ka basatelepono?)
54. Do you hurt your pet dog when it becomes annoyingly noisy? (Sinasaktanmoba ang
alagamongasosatuwingmaingayito?)
55. Do you easily get pissed into children who are experience tantrums? (Napipikon ka basamgabatangmakukulit?)
57. Do you hurt your classmate physically because he/she accuse you as a theft? (Nasaktanmonaba ang
iyongkamagaraldahilsaikaw ay pinagbintangannanagnakaw?)
58. Did you confront your neighbor who is spreading rumors with you and you your family? (Sinugodmonaba ang
kapitbahaynyongmasama ang ugali?)
59. Do you get angry when the one whom you had debt will asked for your payment? (Nagagalit ka
basatuwingsinisingil ka saiyong utang?)
60. Do you feel comfortable and peaceful when you see a beautiful place? (Nagigingmaayosba ang
iyongpakiramdamsatuwingnakakakita ka ng magagandangtanawin?)
INTEREST
2. Do you usually read books during your free time? (Madalas ka bang magbasa ng librosaiyonglibrengoras?)
3. Do you know how to take care and plant a plant? (Marunong ka bang magtanim at mag-alaga ng halaman?)
4. When you are at home, do you cook food for your family? (Kapagnasabahay, ipinaglulutomoba ng pagkain ang
iyongpamilya?)
7. When strolling, do you appreciate scenic views? (Tuwingnamamasyal, naa-appreciate moba ang
magagandangmgatanawin?)
8. Are you good at repairing or fixing things? (Mahusay ka bang magbutingting ng mgagamitsabahay?)
9. Have you tried repairing a broken appliance in your house? (Sinubukanmona bang gawin ang nasirang electrical
appliance sainyongbahay?)
10. Would you like to become a famous actor? (Gusto mo bang magingisangsikatnaaktor?)
13. Would you like to have a business based on your hobbies? (Naismo bang magkaroon ng
sarilingnegosyobataysaiyonghilig?)
14. Do you always want to eat chocolates? (Gusto mo bang kumain ng tsokolate palagi?)
17. Do you love going out rather than staying at home? (Mas gusto mo bang gumalakesamanatilisabahay?)
18. Are you fond of watching news? (Mahilig ka bang manood ng balita?)
19. Do you know about the latest and current happenings in the country? (Alammoba ang mga latest
napangyayarisabansa?)
20. Do you like having snacks while watching television? ( Mahilig ka bang magmeryendahabangnanonood ng
telebisyon?)
21. Do you know how to play any instrument? (Marunong ka bang tumugtog ng kahitanonginstrumento?)
25. Do you like playing mobile games? (Mahilig ka bang maglaro ng games sa cellphone mo?)
27. Are you fond of collecting things? (Mahilig ka bang magkolekta ng mgabagaynahiligmo?)
29. Do you usually attend parties? (Mahilig ka bang um-attend samga party?)
1.
2.
3.
4.
5.
ARITHMETIC
1. ????
a. (-8, 6)
b. (-8, -7)
c. (8, -6)
d. (-8, -6)
e. None of the above.
2. What is the 1st term of the arithmetic sequence if the 9th term is 84 and the 13th term is 44?
a. 164
b. 154
c. 144
d. 134
e. 124
3. What is the 5th term of the geometric sequence 1, -1, 1, -1 ….?
a. 1
b. -1
c. 2
d. -2
e. 0
5. Find the sum of the first 4 terms of the geometric series 10+5+5/2+5/4+⋯
a. 25/4
b. 75/4
c. 125/4
d. 175/4
e. None of The Above
10. Convert the 𝜋 radian to degrees.
a. 180°
b. 360°
c. -180°
d. -360°
e. None of the Above.
11. Which of the following is the vertex of the ellipse 𝑥2100+𝑦2121= ??????
a. (11, 0)
b. (0, -11)
c. (-11, 0)
d. (0,121)
e. None of the Above.
12. Determine the equation of the directrix for the parabola 20𝑥=𝑦2−10𝑦+30
a. x=20
b. y=-20
c. x=-20
d. y=20
e. None of the Above.
13. Determine the sum of all the 1st 30 terms of the sequence 1,2,3,4,5 …..
a. 465
b. 460
c. 455
d. 450
e. 445
26. A hotel chain charges Php 3,750 per night for the first two nights and Php 2,500 for each additional night’s
stay. Find the total bill for a 3 night stay.
a. Php 3,750
b. Php 6,250
c. Php 8,750
d. Php 11,250
e. None of The Above.
MATH
1. Which of the following is NOT a possible value when you roll a regular fair die?
a. Six dots
b. Seven dots
c. Five dots
d. Four dots
e. One dot
2. A random variable X has the probability distribution as in below. What is the probability that X=5?
a. 0.00 X 2 4 6 8
b. 0.10
P(X) 0.10 0.20 0.30 0.40
c. 0.20
d. 0.25
e. 0.30
3. Which of the following is NOT a discrete random variable?
a. Sum of the dots whan a die is rolled
b. Number of glasses of water consumed per day
c. Time it will take for you to travel from your house to your school
d. Number of text messages sent in a day
e. Unit sales of juice bottles
4. The office clerk gave the researcher a list of 500 grade 10 students. The researcher selected every
20th name on the list. What sampling technique is appropriate given the scenario?
a. Systematic sampling
b. Stratified sampling
c. Simple random sampling
d. Cluster sampling
e. Convenience sampling
5. Which of the following is NOT a valid alternative hypothesis?
a. μ>10 days
b. μ=10 days
c. μ<10 days
d. μ ≠10 days
e. All of the above.
6. What can we conclude if there exist a negative strong correlation between variables X and Y?
a. The increase in X causes Y to decrease
b. The increase in X causes Y to increase
c. As the value of X increases the value of Y decreases
d. As the value of X increases the value of Y also increases
e. No conclusion can be made
12
7. Consider the function P ( x ) = for x=1 , 2, 3 and 4. What is the probability that x is between 1 and
25 x
4?
a. 1
b. 2/5
c. 6/25
d. 4/25
e. 12/5
8. A study was conducted to determine the relationship between employee job satisfaction and job
performance. The result of the regression analysis produced the model below:
5 n+10
3. Reduce to lowest terms.
n−4
5
a.
n−2
5
b.
n+2
5n
c.
n−3
5n
d.
n+3
5n
e.
n−2
x−2 x 3
4. What is the least common denominator of + 2 ?
x−1 x −1
a.x 2−1
b.x−1
c.(x +1)( x +1)
d.x +1
e.x ( x−1 )( x +1 )
x−1
x
5. Simplify:
( x−1 )
x2
2
x +1
a.
x +1
2
x +1
b.
x−1
2
x +1
c. 2
x −1
d. x
2
x +1
e. 2
x +1
6. What are the factors of x 2+ 3 x −4 ?
a. (x +2)( x−2)
b. (x +4 )( x−1)
c. (x +4 )( x+1)
d. (x−4)(x−1)
e. (x +4 )( x−2)
7. What is the missing factor of (t−11) if the product is t 2−22 t+121 ?
a. (t+11)
b. (t-11)
c. (t-121)
d. (t-121)
e. (t−10)
8. What is the sum if you add -2x to 7x?
a. 9x
b. -5x
c. 5x
d. -9x
e. 14x
9. Evaluate: 2 a+b 2 for a=3 and b=2.
a. 4
b. 6
c. 8
d. 10
e. 12
10. Solve this equation: 2 n+3=−13
a. -10
b. -8
c. -6
d. 4
e. 2
11. The measure of the longest cord on a circle is 20 cm. What is the measure of its radius?
a. 5 cm
b. 10 cm
c. 15 cm
d. 20 cm
e. 40 cm
12. How many revolutions are there in 5 π radians?
a. 5 revolutions
b. 2.5 revolutions
c. 0.5 revolutions
d. 1/5 revolutions
e. 1 revolutions
( x−7 )2 ( y +4 )2
13. What is the center of the ellipse with the equation + =1 ?
16 25
a. (7,4)
b. (-7,4)
c. (-4,7)
d. (4,-7)
e. (4,5)
3 −12
14. Given: cos A= , A is in QIV, sin B= , 180 °< B< 270° . What is the value of cos ( A + B) ?
5 13
51
a.
65
−63
b.
65
63
c.
65
−51
d.
65
33
e.
65
25.)In a unit circle,an angle in standard position measures 45º.In what quadrant does this angle lie?
a. Quadrant I
b. Quadrant II
c. Quadrant III
d. Quadrant IV
e. Cannot be determined
26.)Which of the following is the possible value of cos x = 1?
a. π rad
π
b. rad
2
3π
c. rad
2
d.2 π rad
e.3 π rad
27.)A rectangular field is to be enclosed with 200 meters of fence.Which of the following models will
express the area of the field as a function of one of its sides,say x?
a. A(x)=x(100-x)
b. A(x)=x(200-x)
c. A(x)=x2(100-x)
d. A(x)=x(100-x)2
e. A(x)=x2(200-x)
28.)What is the coordinate of a 60º angle on the coordinate plane?
1 √3
a.( , )
2 2
√3 1
b. ( , )
2 2
√2 √2
c. ( , )
2 2
d. (0,1)
e.(1,0)
29.)Which of the following is the value of log4(log525)?
a.1/2
b.-1
c.4
d.2
e.20
30.)What is the equation of the vertically-oriented ellipse centered at(2,9) with major and minor axes having
lengths of 20 and 12,respectively?
2 2
( x−2) ( y−9)
a. + =1
36 100
2 2
( x−2) ( y−9)
b. + =1
10 6
( x−2)2 ( y−9)2
c. + =1
100 36
2 2
( x−2) ( y−9)
d. + =1
6 10
2 2
( x +2) ( y +9)
e. + =1
36 100
31.)Which among the following statement is true about the function f(x)=x-1?
a.The function is one to one
b.the inverse of the function exists
c.the graph of the function is a line
d.the function is envertible
e.all of the above
1
32.)What is the domain of the function f(x)= 2 ?
x −9
a. all real numbers excluding zero
b. all real numbers excluding 3 and -3
c. all real numbers greater than 9
d. all real numbers greater than or equal to 9
e. all real numbers greater than 3 and less than -3
1
35.)What is the maturity value of a Php 400,000 debt payable in 2 years at 8 %?
4
a.Php 466,000.00
b.Php 468,000.00
c.Php 470,000.00
d.Php 472,000.00
e.Php 475,000.00
36.)From 2013 through 2018,the sales R1(in thousands of pesos)for one of two restaurants owned by the
same parent company can be modeled by R1=500-6t-0.7t2,t={1,2,3,4,5,6}where t=1 represent 2013.During
the same six-year period,the sales R2(in thousand of pesos)for the second restaurant can be modeled by
R2=300+0.8t,t={1,2,3,4,5,6}.Write a function R3 which represents the total sales of the two restaurants
owned by the same parent company
a. 800+5.2t-0.7t2
b. 200-6.8t-0.7t2
c. 200-5.2t-0.7t2
d. 200+6.8t-0.7t2
e. 800-5.2t-0.7t2
37.)The research and development department of an automobile manufacturer has determined that when a
driver is required to stop quickly to avoid an accident,the distance(in feet)the car travels during the driver’s
3
reaction time is given by R(x)= x,where x is the speed of the car in kilometers per hour.The distance(in
4
2
feet)traveled while the driver is braking is given by B(x)= x2.Find the function that represents the total
5
stopping distance T.
2 3
a. x2+ x
5 4
3
b.1 x3
20
2 3
c. x2- x
5 4
7
d. - x
20
2 3
e. x+ x2
5 4
LOGICAL REASONING
Read the statement on each item and carefully evaluate the given assumptions. Identify which of the following
choices is the most valid and correct conclusion based on the arguments presented.
1. Not many Grade 12 graduates will pursue their college education. All grade 12 graduates have high hopes and
dreams.
a. Several Grade 12 graduates are dreamers.
b. Not all who have high hopes and dreams will pursue college education.
c. All who have high hopes and dreams will pursue college education.
d. Some of those who have high hopes and dreams will pursue college education.
e. None of the above.
4. The students are allowed to play either within the school premises or outside in the park. They are not allowed to
play outside.
a. They stayed in the park.
b. They played only within the school premises.
c. They have strict parents.
d. All of the above.
e. None of the above.
7. Statements: All the harmoniums are instruments. All the instruments are flute.
9. Statements: Some ants are parrots. All of the parrots are green.
10. Statements: Some papers are pens. All the pencils are pens.
Conclusion: 1. Some pens are pencils.
2. Some pens are papers.
a. Only conclusion (1) is valid.
b. Only conclusion (2) is valid.
c. Either (1) or (2) is valid.
d. Neither (1) nor (2) is valid.
e. Both (1) and (2) is valid.
11. Tanya is older than Eric. Cliff is older than Tanya. Eric is older than Cliff. If the first two statements are true, the
third statement is _______________.
a. True
b. False
c. Cannot be determined.
12. Blueberries cost more than strawberries. Blueberries cost less than raspberries. Raspberries cost more than
strawberries and blueberries.
a. True
b. False
c. Cannot be determined.
13. All the trees in the park are fruit-bearing trees. Some of the trees in the park are Mango. All Mango trees in the
park are fruit-bearing trees. If the first two statements are true, the third statement is ________________.
a. True
b. False
c. Cannot be determined.
14. Mina runs faster than Gil. Lita runs faster than Mina. Gil runs faster than Lita. If the first two statements are true,
the third statement is _________________.
a. True
b. False
c. Cannot be determined.
15. Hotels in Fairview cost less than the hotels in Makati. Hotels in Baguio City cost more than hotels in Makati. Of
the three hotels, hotels in Makati cost the most. If the two statements are true, the third statement is
_______________.
a. True
b. False
c. Cannot be determined.
ENGLISH
Select the word that has a similar or opposite meaning to the given word.
1. Mischievous
a. Prankish
b. Happy
c. Mystique
d. Jolly
e. Energetic
2. Rolix
a. Concise
b. Rambling
c. Heard
d. Flop
e. Subside
3. Pedantic
a. Contact
b. Conclusion
c. Corrupt
d. Plain
e. False
4. Novelty
a. Trinket
b. Battery
c. Hive
d. Alteration
e. Poetry
5. Prudence
a. Shame
b. Reverence
c. Temper
d. Levelheadedness
e. Authority
6. Penchant
a. Wisdom
b. Leaning
c. Solidarity
d. Justice
e. Extravagance
7. Camaraderie
a. Sensation
b. Prosperity
c. Redemption
d. Patience
e. Comradery
8. Objective
a. Tepid
b. Standard
c. Substantial
d. Detailed
e. Subjective
VERBAL REASONING
Select the missing word or pair from the choices given to complete the relationship.
14. Historian : Past :: _____ : _____
a. Seer : Future
b. Prophet : Past
c. Dreamer : Present
d. Theologian : Past
e. Professor : Present
19. Without the need to digest food, the giant shipworm’s digestive organs have ______.
a. shrunken
b. shrunk
c. shrink
d. shrank
e. shrinking
20. Kanye ___________ able to articulate himself properly during the VMA’s.
a. couldn’t
b. didn’t
c. isn’t
d. can’t
e. wasn’t
21. Carla _________ playing with her, pretending to fight, until she got bored.
a. would have been
b. have been
c. has been
d. had been
e. None of the Above.
22. The tribe believe in living by hard laws and paying _______ prices.
a. high
b. greater
c. higher
d. great
e. None of the above.
24. The rest of the team would take some time to _________ before the game resumes.
a. prepared
b. prepares
c. prepare
d. preparing
e. None of the above
TECHNICAL WRITING AND ORAL COMMUNICATION
25. This letter describes the relationship of a student applicant to their previous mentors.
a. Acknowledgement letter
b. Recommendation letter
c. Follow up letter
d. Inquiry letter
e. None of the above
27. There must always a/n ____________ on top of the name in the closing line.
a. Stamp
b. Quotation
c. Name
d. Signature
e. None of the above
SCIENCE
1.) Which of the following theories state that the sun is the center of the solar system and the
heavenly bodies revolve around it?
a. Ptolemaic theory
b. Copernican theory
c. big bang theory
d. Buffon’s theory
e. plate tectonic theory
2.) What is the longest division of time in geological scale?
a. eon
b. era
c. epoch
d. period
e. age
3.) Scientists says that some low mountains today were once more than four times higher. What
kind of evidence do scientists use to support such a statement?
a. analysis of ancient written records or drawing of the mountains
b. the amount of volcanic activity in and around the mountains
c. the number and strength of earthquakes in and around the mountains
d. examination of the rock structures and kinds of rocks forming the mountains
e. different layers of soil found beneath the mountain
4.) One type of fish fossil is found only in a rock layer near the bottom of a canyon while a different
kind of fish fossil is found only In a rock layer 4000 feet higher, near the top of the canyon. Which
statement would a scientist most likely offer to explain this situation
a. The fish in the lower layer lived in deeper water that the other fish
b. the fish in the upper layer lived more recently than the other fish
c. the rock in the lower layer is denser than the rock in the upper layer
d. the rock in the upper layer must have formed in fresh water
e. not enough information to draw a valid conclusion
5.) What makes a planet habitable?
a. its atmosphere is made mostly of greenhouse gases making its surface too hot
b. its temperature is low making water freeze into ice
c.it receives sufficient amount of sunlight allowing photosynthesis to occur
d.it receives a very little amount of rainfall allowing almost less nutrient to circulate
e. its land surface is covered with nitrate-rich soil
6.) How does the discovery of radiation coming from all directions in space support the big bang
theory?
a.it indicated that radiation from earth came from space
b.it showed that the radiation could be cosmic background radiation
c.it showed that all of the space has cooled to the same temperature
d.it indicated that thermal energy was distributed in a few choices places
e.it showed that light energy is the purest form of energy
8.) Cancer starts from cells that start to grow uncontrollably fast. They destroy tissues and organs.
What does this say about the effects of diseased cells on the higher levels of organization in an
organism?
a. cancer involves only certain kinds of cells and does not affect any other kind of cell
b. diseased cell affects only the next higher levels of organization that they make up-the tissues
c. diseased cells damage the higher levels of organization they make up: tissues, organs, organ
systems and eventually, the whole organism
d. diseased cells do not affect the other parts of the organism
e. cancer cell cannot propagate easily
9.) What is the original source of energy which flows through a food chain?
a. carbon dioxide
b. glucose
c. oxygen
d.) water
e.) sunlight
10.) In the blood, oxygen quickly binds with hemoglobin. What is hemoglobin?
a. protein in red blood cells
b. protein in white blood cells
c. cells in body tissue
d. genes found in molecules
e. proteins in the blood stream responsible for phagocytosis
11. When a sea star cut into pieces such that each arm has a portion of central disks, each grows
from the rest of the central disk and the four other arm. This demonstrates__________.
a. fragmentation c. regeneration
b. budding d. fission e. magic
12. Down’s syndrome is a genetic disorder in which a person has an extra chromosome. Which of
these characteristics does not describe a person who has it?
a. Chromosome number 21 is affected.
b. he/she flat nose.
c. a person with down’s syndrome are generally tall.
d. a person with down’s syndrome are not generally tall.
e. he/she has moon shaped face.
13. Which of the following are the essential organs of the flower directly concerned with ovulation?
a. petals and sepals b. anther and ovary c. petals and filament d. pistil and stamen e. stigma and
filament
14. What does a person inherit from his or her parents?
a. traits c. chromosomes
b. behavior d. proteins e. genes
15. What gas will be produced from the given equation Mg + H2 SO4 MgSO4?
a. O2 c. O3
b. H2 d. H3 e. O4
16. How many neutrons are in 4020Ca?
a. 40 c. 39
b. 20 d. 60 e. 10
17. IS dealing with the laws governing the behavior gases, the variables that affect their behavior
is/are
a. volume c. temperature
b. pressure d. amount of gas e. all the above
19. The type of chemical reaction involved in the equation BaCl2 + K2CO2 BaCO3 + KCl
a. combination reaction
b. decomposition reaction
c. single replacement
d. double replacement
e. reversible reaction
22.) How many ml of ethyl alcohol are presented in a 150 mL bottle of a 70% alcohol solution?
a.25 mL ethyl alcohol
b.30mL ethyl alcohol
c.50 mL ethyl alcohol
d.75 mL ethyl alcohol
e.105 mL ethyl alcohol
23.) How much work is done by a person applying 10N force for a distance of 10m?
a.100j
b.0j
c.70.7j
d.980j
e.1000j
24.) What happens to the electric flux if the electric field increases?
a.it also increases
b.it decreases
c.it becomes zero
d.it becomes constant
e. not enough information
25.) Light year is a unit of ______
a. time
b. distance
c. light
d. intensity of light
e. mass
27.) A 10-kg mass rests on a frictionless horizontal surface. A 150 N force is exerted horizontally on
the mass. The resulting acceleration is _____
a. 0
b. 10 m/s2
c.20 m/s2
d.25 m/s2
e.15 m/s2
28.) What is the total capacitance if 2 equal capacitors(SF) are connected parallel with each other?
a.10F
b.5F
c.2.5F
d.9F
e.1/5F
30. An object is thrown vertically with velocity of 30 m/s. How long will it take for the object to
reach its maximum height?
a.4.0 s
b.2.0 s
c.1.0 s
d.3.0 s
e.0.5 s
MECHANICAL IQ
1. _____________ is a branch of physical sciences that treats various phenomena of energy and the
related properties of matter, especially of the laws of transformation of heat into other forms of energy
and vice versa.
a. Heat Transfer.
b. Fluid Dynamics.
c. Fluid Mechanics.
d. Thermodynamics.
e. Physics.
2. The upward buoyant force that is exerted on a body immersed in a fluid is equal to the weight of the
fluid that the body displaces. It acts in the upward direction at the center mass of the displaced fluid.
This premis is according to what principle?
a. Archimedes.
b. Plato.
c. Pythagoras.
d. Jara
e. Galileo
3. The standard temperature and pressure are ______K and _______atm, respectively.
a. 0, 1
b. 0, 0
c. 273, 1
d. 100, 0
e. 100, 1
4. In the image shown on the right, which of the points is an approximate position
of the center of gravity for this area?
a. Point 1.
b. Point 2.
c. Point 3.
d. Point 4.
e. Point 5.
6. Which of the following law states that “Energy cannot be created nor be destroyed, it can only be
transformed” ?
a. Boyle’s Law.
b. First Law of Thermodynamics.
c. Zeroth Law of Thermodynamics.
d. Second Law of Thermodynamics.
e. Third Law of Thermodynamics.
7. If your task is to modify geometrical properties of a cross section, which of the following sets of
properties would you consider?
a. Area, Position of Center of Gravity, Mass, Axial Moment of Inertia, Limit Force.
b. Width, Height, Thickness, Area, Position of Center of Gravity, Axial Moment of Inertia.
c. Thickness, Mass, Material Density, Position of Center of Gravity
d. Width, Height, Thickness, Area, Bending Moment
e. Area, Mass, Material Density, Color, Limit Force, Position of Center of Gravity
8. In the image shown on the right, these three thin-walled members are made of sheet of metal of equal
thickness. Which of the following equations best compares the value of axial moments of inertia
about the x axis? (Note: the axial moment of inertia is denoted by I)
a. I1>I2>I3
b. I2>I1>I3
c. I3>I2>I1
d. I3>I1>I2
e. I2>I3>I1
10. It is the property of a material that allows it to deform or to be made into thin wires under the action
of tensile loads plastically.
a. Malleability
b. Plasticity
c. Elasticity
d. Ductility
e. Malleability
11. The elastic modulus is one of the principal material properties used in engineering calculations.
Which of the following statements describes the main purpose of this property?
a. It helps to calculate strain if stress is unknown.
b. It is used in calculations of cross-sectional areas.
c. It is required in calculations of bending moments developed by a force.
d. It is used as the main criteria for concluding whether a structure is strong or not.
e. It is used in calculations of the relationship between the strain developed and the stressed applied.
12. It is the property of a material that is responsible for the deformation in size and shape even after the
load stops acting on it.
a. Malleability
b. Plasticity
c. Elasticity
d. Ductility
e. Malleability
13. A beam is suspended with a steel rope, as shown in the image on the right. Which of the following
types of loading is acting in the rope?
a. Bending
b. Torsion
c. Shear
d. Tension
e. Compression
14. _______________ is a cylindrical machine used to transmit rotary motion and power from a driver to
a driven element.
a. Shaftings
b. Shaft
c. Axle
d. Spindle
e. Keys
15. The image on the right shows a beam that is rectangular in its cross section. Which of the following
operations will increase the load-carrying capacity of this beam?
a. An increase of width b and a reduction of height h.
b. A reduction of height h and width b
c. Nothing will increase the load carrying-capacity.
d. An increase of height h and reduction of width b
e. An increase of width b and height h with the change of the material with higher ultimate stress.
16. The buoyant force is always acting at the ________________ of the submerged volume.
a. Centroid
b. Side
c. Front
d. Bottom
e. Top
17. Consider the image shown on the right. A composite rod is a compound of several different materials
with different mechanical properties. It is placed between two rigid plates and subjected to a
compressive force. Which of the following statements is able to explain the stress and strain
distribution in the composite rod?
a. Stress and strain is equal for all layers of the rod.
b. Stress and strain varies among layers due to their different elastic properties.
c. Strain is unequal for all layers of the rod but stress varies among layers due to their different
elastic properties
d. Strain varies among layers due to their different elastic properties but stress is equal for all layers
of the rod.
e. Length reduction is equal for all layers. Furthermore, stress varies among layers due to their
different elastic properties but strain is equal for all layers of the rod.
18. What is the weight of a mass of 12 kg at a location where the acceleration of gravity is 9.24 m/(s 2)
a. 100.88 N
b. 110.88 N
c. 117.72 N
d. 171.72 N
e. 116.79 N
19. A rod is subjected to a tensile force. The strain developed under loading is 2%. Which of the
following measurements will be the resultant of the length of the rod if its initial length is 200 mm?\
a. 196 mm
b. 204 mm
c. 208 mm
d. 202 mm
e. 210 mm