0% found this document useful (0 votes)
12 views5 pages

Literature

The document discusses a study on the first mitotic division of human embryos. It provides details on the antibodies and suppliers used in the study. It also includes time-course data on cell cycle phases of embryos after release from inhibition at different time points.

Uploaded by

camila peñaloza
Copyright
© © All Rights Reserved
We take content rights seriously. If you suspect this is your content, claim it here.
Available Formats
Download as PDF, TXT or read online on Scribd
0% found this document useful (0 votes)
12 views5 pages

Literature

The document discusses a study on the first mitotic division of human embryos. It provides details on the antibodies and suppliers used in the study. It also includes time-course data on cell cycle phases of embryos after release from inhibition at different time points.

Uploaded by

camila peñaloza
Copyright
© © All Rights Reserved
We take content rights seriously. If you suspect this is your content, claim it here.
Available Formats
Download as PDF, TXT or read online on Scribd
You are on page 1/ 5

Article Title Journal Year DOI Relevant points

The first mitotic division of human embryos is highly


error prone Nature communications 2022 10.1038/s41467-022-34294-6 https://www.nature.com/articles/s41467-022-34294-6#citeas
https://www.science.org/doi/10.
1126/science.1235532 cenpc motifs, why theantibodies used didn't work
group Supplier Reactivity Clonality Isotype Dilution
https://www.cellsignal.com/products/primary-
antibodies/cenp-a-c51a7-rabbit-mab-mouse-
Anti-CENP-A Cell signaling technology #2048 Mouse Monoclonal Rabbit 1:10, 1:50 180 amino terminus of mouse CENP-A protein specific/2048
Anti-CENP-A Biozol MBL-D115-3MS Human Monoclonal Mouse 1:10 1129 - https://www.biozol.de/de/product/mbl-d115-3ms
https://www.abcam.com/cenpb-antibody-
Anti-CENP-B abcam ab25734 Human Polyclonal Rabbit 1:50, 1:100 231 residues 550 to the C-terminus of Human CENPB ab25734.html
https://www.abcam.com/cenpc-antibody-
Anti-CENP-C abcam ab50974 Human Monoclonal Mouse 1:10, 1:50, 1:100 130 Human CENPC aa 655-768 2159c5a-ab50974.html KPQTSGYTCNIPTESNLDSGEHKTSVLEESGPSRLNNNYLMSGKNDVDDE EVHGSSDDSKQSKVIPKNRIHHKLVLPSNTPNVRRTKRTRLKPLEYWRGE RIDYQGRPSGGFVI
644-943 mapping at the C-terminus of CENP-C of
Anti-CENP-C Santa Cruz Biotechnology sc-166099
Human Monoclonal Mouse 1:10, 1:50 1115 human origin https://www.scbt.com/p/cenp-c-antibody-c-6
Anti-CENP-C MBL PD030MS Human Polyclonal Guinea pig 1:10 755 N-terminal (1-426 aa) https://ruo.mbl.co.jp/bio/e/dtl/A/?pcd=PD030MS
Anti-CENP-C Biozol A3975 - Monoclonal Rabbit 1:10 1128 -
Anti-CENP-C MBL PD030. Human Polyclonal Rabbit 1:20, 1:100 1477 N-terminal (1-426 aa)
Accession number AlphaFold
Group Organism Database Accession number Sequence Structure prediction
CENP-A Cow UniProt P49449 AF-P49449-F1
CENP-A Human UniProt P49450 AF-P49450-F1
CENP-A Mouse UniProt O35216 AF-O35216-F1
CENP-B Cow NCBI Protein Database XP_024856844.1 -
CENP-B Human UniProt P07199 -
CENP-B Mouse UniProt P27790 -
CENP-C Cow NCBI Protein Database NP_001039346.2 -
CENP-C Human UniProt Q03188 AF-Q03188-F1
CENP-C Mouse UniProt P49452 AF-P49452-F1
Time after RO-3306 release Cell cycle phase % n Time Cell cycle phase % n
1.83 h M2 2,1 1 14 h M2 0,0 0 A C 0
1.83 h Pronuclei 20,8 10 14 h Pronuclei 4,0 1 A D 4.0
1.83 h NEBD 31,3 15 14 h NEBD 0,0 0 A E 0
1.83 h Metaphase 20,8 10 14 h Metaphase 12,0 3 A F 12
1.83 h Anaphase 10,4 5 14 h Anaphase 0,0 0 A G 0
1.83 h Telophase 0,0 0 14 h Telophase 0,0 0 A H 0
1.83 h ≥ 2-cell 14,6 7 14 h ≥ 2-cell 84,0 21 A I 84
TOTAL 48 Time after Thymidine release TOTAL 25 B C 0
B D 11.8
2h M2 0 0 4h M2 0,0 0 B E 11.8
2h Pronuclei 18,75 3 4h Pronuclei 11,8 2 B F 0
2h NEBD 25 4 4h NEBD 11,8 2 B G 0
2h Metaphase 6,25 1 4h Metaphase 0,0 0 B H 0
2h Anaphase 12,5 2 4h Anaphase 0,0 0 B I 76.5
2h Telophase 18,75 3 4h Telophase 0,0 0
2h ≥ 2-cell 18,75 3 4h ≥ 2-cell 76,5 13
TOTAL 16

2.25 h M2 8,82 3 TOTAL 17


2.25 h Pronuclei 35,29 12
2.25 h NEBD 26,47 9
2.25 h Metaphase 14,71 5
2.25 h Anaphase 2,94 1
2.25 h Telophase 2,94 1
2.25 h ≥ 2-cell 8,82 3
TOTAL 34

2.50 h M2 0,00 0
2.50 h Pronuclei 25,00 7
2.50 h NEBD 21,43 6
2.50 h Metaphase 14,29 4
2.50 h Anaphase 7,14 2
2.50 h Telophase 17,86 5
2.50 h ≥ 2-cell 14,29 4
TOTAL 28

2.67 h M2 7,14 1
2.67 h Pronuclei 28,57 4
2.67 h NEBD 14,29 2
2.67 h Metaphase 7,14 1
2.67 h Anaphase 14,29 2
2.67 h Telophase 0,00 0
2.67 h ≥ 2-cell 28,57 4
TOTAL 14

2h* M2 23,68 9
2h* Pronuclei 31,58 12
2h* NEBD 15,79 6
2h* Metaphase 10,53 4
2h* Anaphase 0,00 0
2h* Telophase 2,63 1
2h* ≥ 2-cell 15,79 6
TOTAL 38

2 h ** M2 9,30 4
2 h ** Pronuclei 44,19 19
2 h ** NEBD 11,63 5
2 h ** Metaphase 6,98 3
2 h ** Anaphase 0,00 0
2 h ** Telophase 16,28 7
2 h ** ≥ 2-cell 11,63 5
TOTAL 43
Article Title Journal Year DOI Relevant points
-Heparin could imrpove oocyte maturation as is a common component of ooplasm,
follicular fluid. Heparin reduces oocyte development: the appereance of 1 polar body
Heparin effect on in vitro nuclear maturation of
and GV breakdown occurs earlier. It might also support IVF, since parental pronuclei
bovine oocytes develop better with this treatment. No effects on embryos are seen. Heparin is also
Zygote 2008 10.1017/S0967199407004418 used for capacitation of sperm.

You might also like