Input output statement in C
Download as pptx, pdf0 likes1,851 views
The document discusses input/output functions in C programming. It describes the scanf() function for input, which reads data from variables using format specifiers in a control string. It also describes printf() for output, which prints values to the screen using format specifiers. Additional functions getchar() and putchar() are discussed for reading and writing single characters respectively.
1 of 6
Download to read offline
Ad
Recommended
Unit 3. Input and Output
Unit 3. Input and OutputAshim Lamichhane This document discusses input and output operations in C programming. It explains that input/output functions provide the link between the user and terminal. Standard input functions like scanf() are used to read data from keyboard while standard output functions like printf() display results on screen. Formatted functions like scanf() and printf() allow input/output to be formatted according to requirements. Unformatted functions like getchar() and putchar() deal with single characters. The standard library stdio.h provides predefined functions for input and output in C.
Presentation on computer
Presentation on computerNausad Ahamed This document provides an overview of computers, including:
1. It classifies computers into microcomputers, minicomputers, mainframe computers, and supercomputers based on their processing ability and speed.
2. It describes hardware as the physical and tangible parts of a computer like motherboards, drives, and peripherals. Software is defined as programs and data that provide instructions.
3. Input and output devices are discussed as facilitating information capture, processing, and presentation between the computer and user.
Zener Diode Full Presentation 
Zener Diode Full Presentation Adeel Rasheed On this presentation i describe all the features and types of diode. This presentation started from short but understandable history of diode or zener . How diode is working? Answer of this question also clear after read all this presentation.
Operators in C Programming
Operators in C Programmingprogramming9 Various Operators in C programming. It is useful for beginners of C Programming.
www.programming9.com
www.facebook.com/programming9
PRESENTATION ON COMPUTER SYSTEM
PRESENTATION ON COMPUTER SYSTEMDeepanshu Saini A computer is an electronic device that can perform a variety of tasks by executing instructions. It is comprised of a central processing unit that carries out computer programs, a monitor for visual display, a mouse for pointing and selecting items, a keyboard for inputting text and commands, a printer for producing physical copies, a modem for connecting to networks, and speakers for audio output. Key characteristics of computers include their speed, accuracy, reliability, large storage capacity, versatility in handling many different tasks, and ability to reduce the need for manpower and paper work.
Introduction to C programming
Introduction to C programmingRokonuzzaman Rony This document provides an introduction to the C programming language. It discusses the history of C, how it was developed as a general purpose language, and why it is still widely used today. The key points covered include:
- C was created in the early 1970s and was the language used to write the UNIX operating system. It provides efficiency and portability.
- The document reviews basic C concepts like variables, data types, operators, functions, and control structures.
- It also describes the typical stages of a C software development process: requirements, analysis, design, implementation, testing, and debugging.
Internet of Things (IoT) and its applications
Internet of Things (IoT) and its applicationsSarwan Singh PPT discusses Iot, its uses and applications. The draft IoT policy by DeitY, Govt. of India is also briefly discussed.
Introduction to seven segment display new
Introduction to seven segment display newRohit Roy This presentation summarizes a summer training project on 7-segment displays completed at ARMbedded Electronics Pvt. Ltd. ARMbedded is an embedded design company registered under the Indian Companies Act of 1956. The presentation covers an introduction to LEDs and how they work, the different types of 7-segment displays, and how to drive a 7-segment display using switches or a 4511 IC. It explains that 7-segment displays are useful for displaying numeric digits in devices and discusses applications of 7-segment displays.
File handling in c
File handling in caakanksha s File handling in C programming uses file streams as the means of communication between programs and data files. The input stream extracts data from files and supplies it to the program, while the output stream stores data from the program into files. To handle file input/output, header file fstream.h is included, which contains ifstream and ofstream classes. Common file operations include opening, reading, writing, and closing files using functions like fopen(), fgetc(), fputs(), fclose(), and checking for end-of-file conditions. Files can be opened in different modes like read, write, append depending on the operation to be performed.
C tokens
C tokensManu1325 C programs are composed of six types of tokens: keywords, identifiers, constants, strings, special symbols, and operators. Keywords are reserved words that serve as building blocks for statements and cannot be used as names. Identifiers name variables, functions, and arrays and must begin with a letter. Constants represent fixed values and come in numeric, character, and string forms. Special symbols include braces, parentheses, and brackets that indicate code blocks, function calls, and arrays. Operators perform arithmetic, assignment, comparison, logic, and other operations.
Structure of a C program
Structure of a C programDavid Livingston J This document provides an overview of the basic structure and components of a C program. It discusses the main parts including preprocessor directives like #include and #define, comments, data types, variables, statements, functions, and input/output functions like printf, scanf, getchar and putchar. It explains that a C program requires a main function and can declare global variables and functions. The document also covers format specifiers and escape sequences used with functions like printf.
Memory allocation in c
Memory allocation in cPrabhu Govind The document discusses dynamic memory allocation in C. It describes the four main functions for dynamic allocation - malloc(), calloc(), free(), and realloc(). malloc() allocates a block of memory of a specified size and returns a pointer. calloc() allocates multiple blocks of memory and initializes them to zero. free() releases previously allocated memory. realloc() changes the size of previously allocated memory. The document provides examples of using each function.
Dynamic memory allocation
Dynamic memory allocationViji B Dynamic memory allocation allows programs to request memory from the operating system at runtime. This memory is allocated on the heap. Functions like malloc(), calloc(), and realloc() are used to allocate and reallocate dynamic memory, while free() releases it. Malloc allocates a single block of uninitialized memory. Calloc allocates multiple blocks of initialized (zeroed) memory. Realloc changes the size of previously allocated memory. Proper use of these functions avoids memory leaks.
C programming - String
C programming - StringAchyut Devkota 1. A string is a one-dimensional array of characters terminated by a null character. Strings can be initialized during compilation or at runtime.
2. Common string functions like scanf(), gets(), getchar() are used to input strings while printf(), puts(), putchar() are used to output strings.
3. Library functions like strcpy(), strcat(), strcmp(), strlen() allow manipulation of strings like copying, concatenation, comparison and finding length.
User defined functions in C
User defined functions in CHarendra Singh User defined / Pre-defined functions in C
Function declaration, Function Call, Function definition, Types of functions, Categories of functions
Formatted input and output
Formatted input and outputOnline This document discusses input and output streams in C++. It explains that streams are sequences of characters that move from a source to a destination, and covers input streams from devices to a computer and output streams from the computer to devices. It also details the standard input stream cin and standard output stream cout, and how to use various manipulators to format output, such as setprecision, fixed, showpoint, setw, setfill, left, and right.
Unit 2. Elements of C
Unit 2. Elements of CAshim Lamichhane C Tokens, Escape sequence, Delimiters, Variables, Data types, Constants/ Literals, Expressions, Statements and Comments
https://github.com/ashim888/csit-c
C functions
C functionsUniversity of Potsdam A function is a group of statements that together perform a task. Every C program has at least one function, which is main(), and all the most trivial programs can define additional functions. You can divide up your code into separate functions.
Function in C program
Function in C programNurul Zakiah Zamri Tan The document discusses functions in C programming. It defines functions as self-contained blocks of code that perform a specific task. Functions make a program more modular and easier to debug by dividing a large program into smaller, simpler tasks. Functions can take arguments as input and return values. Functions are called from within a program to execute their code.
Constants in C Programming
Constants in C Programmingprogramming9 It explains various types of Constants in c Programming. It explains Integer, Real, Character and String Constants in c Programming.
Strings in c++
Strings in c++Neeru Mittal This document discusses strings in C++. It begins by explaining that strings are stored as character arrays terminated by a null character. It then covers declaring and initializing strings, accessing characters within strings, inputting and outputting strings using cin, gets(), and getline(), and comparing and copying strings. The document also discusses two-dimensional character arrays for storing arrays of strings. It provides examples of initializing, inputting, and displaying 2D string arrays.
Array in c
Array in cRavi Gelani The document discusses different types of arrays in C programming language. It defines an array as a fixed-size sequential collection of elements of the same data type. It describes one-dimensional, two-dimensional and multidimensional arrays. For one-dimensional arrays, it provides examples of declaration, initialization at compile-time and run-time. For two-dimensional arrays, it explains the memory layout and initialization syntax. It also lists some applications of arrays.
Data types in C
Data types in CTarun Sharma This document discusses various data types in C programming. It covers primary data types like int, char, float, and void. It also discusses derived data types such as arrays, pointers, enumerated data types, structures, and typedef. For each data type, it provides details on usage, memory size, value ranges, and examples.
Basics of c++ Programming Language
Basics of c++ Programming LanguageAhmad Idrees The aim of this list of programming languages is to include all notable programming languages in existence, both those in current use and ... Note: This page does not list esoteric programming languages. .... Computer programming portal ...
File in C language
File in C languageManash Kumar Mondal A file is a collection of related data that a computer treats as a single unit. Files allow data to be stored permanently even when the computer is shut down. C uses the FILE structure to store attributes of a file. Files allow for flexible data storage and retrieval of large data volumes like experimental results. Key file operations in C include opening, reading, writing, and closing files. Functions like fopen(), fread(), fwrite(), fclose() perform these operations.
Computer Fundamentals & Intro to C Programming module i
Computer Fundamentals & Intro to C Programming module iAjit Nayak Introduction to Computers
Evolution of Computers
Computer Generations
Basic Computer Organization
Memory Hierarchy
I/O devices
Computer Software
Planning Computer Program
Introduction to C programming
Structure of C Programming
Datatype
Constant
Variable
Expression
Conditional Expression
Precede
Functions in c
Functions in csunila tharagaturi The document discusses functions in C programming. The key points are:
1. A function is a block of code that performs a specific task. Functions allow code reusability and modularity.
2. main() is the starting point of a C program where execution begins. User-defined functions are called from main() or other functions.
3. Functions can take arguments and return values. There are different ways functions can be defined based on these criteria.
4. Variables used within a function have local scope while global variables can be accessed from anywhere. Pointers allow passing arguments by reference.
History of c
History of cShipat Bhuiya C was developed in the early 1970s by Dennis Ritchie at Bell Labs as an evolution of ALGOL, BCPL, and B programming languages. It became widely popular after the publication of "The C Programming Language" book in 1978. C was later standardized as ANSI C in 1989 and ISO/IEC 9899 in 1990. The language continued to evolve with extensions and refinements such as C99. C remains one of the most widely used programming languages due to its portability and role in developing operating systems like UNIX.
CHAPTER 4
CHAPTER 4mohd_mizan This document discusses input and output statements in C programming. It defines input/output statements and explains their function of accepting input from and displaying output to devices like the keyboard, monitor, and error device. It provides examples of using standard functions like printf(), scanf(), gets(), and puts() for formatted input and output of different data types. It also covers format specifiers used with these functions to read from and write to variables of specific types like integers, characters, and floating-point numbers.
MANAGING INPUT AND OUTPUT OPERATIONS IN C MRS.SOWMYA JYOTHI.pdf
MANAGING INPUT AND OUTPUT OPERATIONS IN C MRS.SOWMYA JYOTHI.pdfSowmyaJyothi3 MANAGING INPUT AND OUTPUT OPERATIONS IN C
REFERENCES: PROGRAMMING IN C BY BALAGURUSWAMY
MRS.SOWMYA JYOTHI,SDMCBM,MANGALORE
More Related Content
What's hot (20)
File handling in c
File handling in caakanksha s File handling in C programming uses file streams as the means of communication between programs and data files. The input stream extracts data from files and supplies it to the program, while the output stream stores data from the program into files. To handle file input/output, header file fstream.h is included, which contains ifstream and ofstream classes. Common file operations include opening, reading, writing, and closing files using functions like fopen(), fgetc(), fputs(), fclose(), and checking for end-of-file conditions. Files can be opened in different modes like read, write, append depending on the operation to be performed.
C tokens
C tokensManu1325 C programs are composed of six types of tokens: keywords, identifiers, constants, strings, special symbols, and operators. Keywords are reserved words that serve as building blocks for statements and cannot be used as names. Identifiers name variables, functions, and arrays and must begin with a letter. Constants represent fixed values and come in numeric, character, and string forms. Special symbols include braces, parentheses, and brackets that indicate code blocks, function calls, and arrays. Operators perform arithmetic, assignment, comparison, logic, and other operations.
Structure of a C program
Structure of a C programDavid Livingston J This document provides an overview of the basic structure and components of a C program. It discusses the main parts including preprocessor directives like #include and #define, comments, data types, variables, statements, functions, and input/output functions like printf, scanf, getchar and putchar. It explains that a C program requires a main function and can declare global variables and functions. The document also covers format specifiers and escape sequences used with functions like printf.
Memory allocation in c
Memory allocation in cPrabhu Govind The document discusses dynamic memory allocation in C. It describes the four main functions for dynamic allocation - malloc(), calloc(), free(), and realloc(). malloc() allocates a block of memory of a specified size and returns a pointer. calloc() allocates multiple blocks of memory and initializes them to zero. free() releases previously allocated memory. realloc() changes the size of previously allocated memory. The document provides examples of using each function.
Dynamic memory allocation
Dynamic memory allocationViji B Dynamic memory allocation allows programs to request memory from the operating system at runtime. This memory is allocated on the heap. Functions like malloc(), calloc(), and realloc() are used to allocate and reallocate dynamic memory, while free() releases it. Malloc allocates a single block of uninitialized memory. Calloc allocates multiple blocks of initialized (zeroed) memory. Realloc changes the size of previously allocated memory. Proper use of these functions avoids memory leaks.
C programming - String
C programming - StringAchyut Devkota 1. A string is a one-dimensional array of characters terminated by a null character. Strings can be initialized during compilation or at runtime.
2. Common string functions like scanf(), gets(), getchar() are used to input strings while printf(), puts(), putchar() are used to output strings.
3. Library functions like strcpy(), strcat(), strcmp(), strlen() allow manipulation of strings like copying, concatenation, comparison and finding length.
User defined functions in C
User defined functions in CHarendra Singh User defined / Pre-defined functions in C
Function declaration, Function Call, Function definition, Types of functions, Categories of functions
Formatted input and output
Formatted input and outputOnline This document discusses input and output streams in C++. It explains that streams are sequences of characters that move from a source to a destination, and covers input streams from devices to a computer and output streams from the computer to devices. It also details the standard input stream cin and standard output stream cout, and how to use various manipulators to format output, such as setprecision, fixed, showpoint, setw, setfill, left, and right.
Unit 2. Elements of C
Unit 2. Elements of CAshim Lamichhane C Tokens, Escape sequence, Delimiters, Variables, Data types, Constants/ Literals, Expressions, Statements and Comments
https://github.com/ashim888/csit-c
C functions
C functionsUniversity of Potsdam A function is a group of statements that together perform a task. Every C program has at least one function, which is main(), and all the most trivial programs can define additional functions. You can divide up your code into separate functions.
Function in C program
Function in C programNurul Zakiah Zamri Tan The document discusses functions in C programming. It defines functions as self-contained blocks of code that perform a specific task. Functions make a program more modular and easier to debug by dividing a large program into smaller, simpler tasks. Functions can take arguments as input and return values. Functions are called from within a program to execute their code.
Constants in C Programming
Constants in C Programmingprogramming9 It explains various types of Constants in c Programming. It explains Integer, Real, Character and String Constants in c Programming.
Strings in c++
Strings in c++Neeru Mittal This document discusses strings in C++. It begins by explaining that strings are stored as character arrays terminated by a null character. It then covers declaring and initializing strings, accessing characters within strings, inputting and outputting strings using cin, gets(), and getline(), and comparing and copying strings. The document also discusses two-dimensional character arrays for storing arrays of strings. It provides examples of initializing, inputting, and displaying 2D string arrays.
Array in c
Array in cRavi Gelani The document discusses different types of arrays in C programming language. It defines an array as a fixed-size sequential collection of elements of the same data type. It describes one-dimensional, two-dimensional and multidimensional arrays. For one-dimensional arrays, it provides examples of declaration, initialization at compile-time and run-time. For two-dimensional arrays, it explains the memory layout and initialization syntax. It also lists some applications of arrays.
Data types in C
Data types in CTarun Sharma This document discusses various data types in C programming. It covers primary data types like int, char, float, and void. It also discusses derived data types such as arrays, pointers, enumerated data types, structures, and typedef. For each data type, it provides details on usage, memory size, value ranges, and examples.
Basics of c++ Programming Language
Basics of c++ Programming LanguageAhmad Idrees The aim of this list of programming languages is to include all notable programming languages in existence, both those in current use and ... Note: This page does not list esoteric programming languages. .... Computer programming portal ...
File in C language
File in C languageManash Kumar Mondal A file is a collection of related data that a computer treats as a single unit. Files allow data to be stored permanently even when the computer is shut down. C uses the FILE structure to store attributes of a file. Files allow for flexible data storage and retrieval of large data volumes like experimental results. Key file operations in C include opening, reading, writing, and closing files. Functions like fopen(), fread(), fwrite(), fclose() perform these operations.
Computer Fundamentals & Intro to C Programming module i
Computer Fundamentals & Intro to C Programming module iAjit Nayak Introduction to Computers
Evolution of Computers
Computer Generations
Basic Computer Organization
Memory Hierarchy
I/O devices
Computer Software
Planning Computer Program
Introduction to C programming
Structure of C Programming
Datatype
Constant
Variable
Expression
Conditional Expression
Precede
Functions in c
Functions in csunila tharagaturi The document discusses functions in C programming. The key points are:
1. A function is a block of code that performs a specific task. Functions allow code reusability and modularity.
2. main() is the starting point of a C program where execution begins. User-defined functions are called from main() or other functions.
3. Functions can take arguments and return values. There are different ways functions can be defined based on these criteria.
4. Variables used within a function have local scope while global variables can be accessed from anywhere. Pointers allow passing arguments by reference.
History of c
History of cShipat Bhuiya C was developed in the early 1970s by Dennis Ritchie at Bell Labs as an evolution of ALGOL, BCPL, and B programming languages. It became widely popular after the publication of "The C Programming Language" book in 1978. C was later standardized as ANSI C in 1989 and ISO/IEC 9899 in 1990. The language continued to evolve with extensions and refinements such as C99. C remains one of the most widely used programming languages due to its portability and role in developing operating systems like UNIX.
Similar to Input output statement in C (20)
CHAPTER 4
CHAPTER 4mohd_mizan This document discusses input and output statements in C programming. It defines input/output statements and explains their function of accepting input from and displaying output to devices like the keyboard, monitor, and error device. It provides examples of using standard functions like printf(), scanf(), gets(), and puts() for formatted input and output of different data types. It also covers format specifiers used with these functions to read from and write to variables of specific types like integers, characters, and floating-point numbers.
MANAGING INPUT AND OUTPUT OPERATIONS IN C MRS.SOWMYA JYOTHI.pdf
MANAGING INPUT AND OUTPUT OPERATIONS IN C MRS.SOWMYA JYOTHI.pdfSowmyaJyothi3 MANAGING INPUT AND OUTPUT OPERATIONS IN C
REFERENCES: PROGRAMMING IN C BY BALAGURUSWAMY
MRS.SOWMYA JYOTHI,SDMCBM,MANGALORE
Basic Input and Output
Basic Input and OutputNurul Zakiah Zamri Tan The document discusses various input and output functions in C programming. It describes scanf() and printf() for input and output without spaces, gets() and puts() for multi-word input and output, getchar() and putchar() for single character input and output, and getch() and putch() for single character input and output without pressing enter. It also covers format specifiers used with these functions and escape sequences.
Mesics lecture 5 input – output in ‘c’
Mesics lecture 5 input – output in ‘c’eShikshak Formatted functions like printf() and scanf() allow input and output to be formatted according to specifications. printf() displays output with a format string and variable values. scanf() reads input values and assigns them to variables. Unformatted functions like getchar(), putchar(), and gets() work with character and string data types without formatting.
Mesics lecture 5 input – output in ‘c’
Mesics lecture 5 input – output in ‘c’eShikshak 1. There are two main ways to handle input-output in C - formatted functions like printf() and scanf() which require format specifiers, and unformatted functions like getchar() and putchar() which work only with characters.
2. Formatted functions allow formatting of different data types like integers, floats, and strings. Unformatted functions only work with characters.
3. Common formatted functions include printf() for output and scanf() for input. printf() outputs data according to format specifiers, while scanf() reads input and stores it in variables based on specifiers.
Lecture-2.pptxefygefyeyyegfygcyewvwvvcvywcy
Lecture-2.pptxefygefyeyyegfygcyewvwvvcvywcyhamzah7958 wueygfywgywchcbyegfvcvedcbnbHvuvefvwevcvcvyev mNASBCh
Introduction to Basic C programming 02
Introduction to Basic C programming 02Wingston This presentation offers complete basic users a simple guide to the C programming Language in a practical manner
Unit 2- Module 2.pptx
Unit 2- Module 2.pptxsimranjotsingh2908 This document discusses tokens in the C programming language. It defines tokens as the basic building blocks of a C program, including keywords, identifiers, constants, string literals, and symbols. It provides examples of different token types and explains their meanings. It also covers identifiers, keywords, variables, constants, strings, input/output functions, and writing a basic C program.
Input And Output
Input And OutputGhaffar Khan The document discusses input and output functions in C programming. It describes getchar() and putchar() for character input/output, printf() and scanf() for formatted input/output, and gets() and puts() for string input/output. It provides examples of using these functions to read input from the keyboard and display output to the screen.
scanf function in c, variations in conversion specifier
scanf function in c, variations in conversion specifierherosaikiran This document discusses format specifiers for the scanf() function in C. It explains that scanf() uses a format string to interpret input data and store it in memory. Common format specifiers include %d for integers, %f for floats, %c for characters, and %s for strings. It also describes an unusual format specifier, %[^\n], which reads characters until a newline is encountered. Finally, it analyzes the %[] specifier in more detail, explaining how it can match or exclude certain character sets.
Fundamental of C Programming Language and Basic Input/Output Function
Fundamental of C Programming Language and Basic Input/Output Functionimtiazalijoono
Fundamental of C Programming Language
and
Basic Input/Output Function
contents
C Development Environment
C Program Structure
Basic Data Types
Input/Output function
Common Programming Error
input
inputteach4uin This document discusses input and output formatting in C using printf and scanf. It covers:
1. Streams for input and output and standard streams like stdin and stdout.
2. Formatting output with printf using conversion specifiers for integers, floats, strings, and other data types as well as flags, field widths, and precision.
3. Formatting input with scanf using similar conversion specifiers and capabilities to read various data types from input.
Input and Output In C Language
Input and Output In C LanguageAdnan Khan This document discusses standard input/output functions in C language. It provides examples of functions like printf(), scanf(), gets(), puts() to take input from keyboard and display output. It explains format specifiers like %d, %f used with these functions. Escape sequences and functions like getch(), getche(), clrscr() for character input and screen clearing are also covered along with examples.
Concepts of C [Module 2]![Concepts of C [Module 2]](https://cdn.slidesharecdn.com/ss_thumbnails/conceptsofcm2-p1-150416080853-conversion-gate02-thumbnail.jpg?width=560&fit=bounds)
Concepts of C [Module 2]Abhishek Sinha It is an attempt to make the students of IT understand the basics of programming in C in a simple and easy way. Send your feedback for rectification/further development.
2 3. standard io
2 3. standard io웅식 전 The document discusses the standard input/output functions printf() and scanf() in C programming. printf() is used to print output to the monitor and allows formatting of output using conversion characters like %d for integers and %f for floating point numbers. scanf() reads input from standard input using similar conversion characters. Examples are given to demonstrate printing integers and floating point numbers with various width and precision specifications, as well as a basic program using scanf() to read user input.
CPU INPUT OUTPUT 
CPU INPUT OUTPUT Aditya Vaishampayan The document discusses input and output functions in C programming. It describes formatted functions like printf() and scanf() that allow input and output with formatting. It also describes unformatted functions like getchar(), putchar(), gets(), and puts() that handle character and string input/output without formatting. The formatted functions require format specifiers while the unformatted functions work only with character data types.
Fucntions & Pointers in C
Fucntions & Pointers in CJanani Satheshkumar Functions allow programmers to organize code into reusable blocks. There are two types of functions: pre-defined/library functions which are provided for use and user-defined functions which are created by the programmer. User-defined functions help reduce code length and make debugging easier. Functions can receive input parameters, return values, or do both. Arrays allow storing and accessing related data through indexes. One-dimensional arrays store data in a single list while multi-dimensional arrays can represent tables of data through multiple indexes.
C language
C languageTaranjeetKaur72 Variables, constants, I/O functions & Header Files document discusses:
1. Variables in C - Variables store data in memory locations and can change value. They are declared with a data type and name.
2. Constants in C - Constants cannot change value once declared. They include integer, floating point, character, and string literals.
3. Input/output functions in C - These allow programs to accept input and display output. Formatted functions like printf() and scanf() control formatting while unformatted functions like getch() and putch() do not.
4. Header files in C - Header files contain predefined library functions and are included using #include to access standard functions.
Introduction to C Programming
Introduction to C ProgrammingAniket Patne This PPT is all about INTRODUCTION TO C LANGUAGE in which all basic topics are covered and the information present in this is refered from a book called "Let Us C" by YASHAVANT KANETKAR i.e. This PPT is having all important points of first chapter of "Let Us C". If any doubt plz ask us in comment.
string , pointer
string , pointerArafat Bin Reza This document contains information about strings in C programming language. It defines strings as arrays of characters terminated by a null character. It discusses different ways to declare and initialize string variables including using character arrays and pointers. It also covers common string handling functions like strcat(), strcpy(), strlen(), strcmp(), strcmpi() which are used for string manipulation. Examples are given to demonstrate the use of these functions. The document also discusses pointers in C and provides examples of pointer declaration, initialization, dereferencing and using pointers to access structure members.
Ad
More from Muthuganesh S (12)
javascript.pptx
javascript.pptxMuthuganesh S This document provides an introduction and overview of JavaScript including:
- JavaScript is a lightweight, dynamic programming language used for client-side web development. Programs written in JavaScript are called scripts.
- The main advantages of JavaScript are its simplicity, speed, popularity, use in web development and games.
- To run a basic JavaScript program, code is written within <script> tags in an HTML file and run in a browser.
- Variables, data types, functions, operators and dialog boxes are also discussed at a high level.
Operation Research VS Software Engineering
Operation Research VS Software EngineeringMuthuganesh S The document provides an overview of operations research and its applications. It defines operations research as the scientific study of operations to make better decisions. It then outlines the typical steps involved: (1) defining the problem and gathering data; (2) formulating a model to represent the problem; (3) deriving solutions from the model; and (4) validating the model. It provides examples of applying operations research to problems in transportation, business, and tuberculosis treatment and prevention.
Cnotes
CnotesMuthuganesh S This document provides an introduction and overview of the C programming language. It begins with a brief history of C and discusses its importance. It then describes the basic structures of a C program, including common sections like the documentation, include, definition, global declaration, main function, and subprogram sections. It also covers C libraries and common header files. The document continues with explanations of constants, variables, data types, and operators in C. It provides details on integer, floating point, character, and void data types. Finally, it discusses defining and declaring variables in C.
CSS
CSSMuthuganesh S CSS (Cascading Style Sheets) is a language used to style and lay out web pages. It allows separation of document content from document presentation through external style sheets. There are three main ways to insert CSS - external, internal, and inline. CSS rules are made up of selectors and declarations, where declarations include properties and values separated by a colon. Common selectors include element, id, class, universal, and group selectors. External style sheets can change the look of an entire website by editing just one CSS file linked across pages.
Conditional statement in c
Conditional statement in cMuthuganesh S The document discusses different types of conditional statements in C including if, if-else, nested if-else, if-else ladder, switch, and goto statements. It provides the syntax and explains the logic and flow of each statement. The if statement executes code if a condition is true. The if-else statement executes one block if true and another if false. Nested if-else tests multiple conditions in sequence. The if-else ladder tests conditions from top to bottom. Switch compares a value to multiple cases and executes the matching block. Goto unconditionally transfers control to a labeled statement.
Php notes
Php notesMuthuganesh S This document contains notes on PHP covering topics such as:
- PHP is a popular scripting language suited for web development created by Rasmus Lerdorf in 1994.
- Advantages of PHP include being open source, supporting many databases, and being platform independent.
- PHP can be used to build dynamic web applications with MySQL, handle dynamic content and sessions, and encrypt data.
- XAMPP is a free and open source package used to install PHP on Windows, Linux, and Mac operating systems.
- PHP variables, constants, data types, functions, and operators are explained.
Php Basics Iterations, looping
Php Basics Iterations, loopingMuthuganesh S This document discusses various PHP looping structures including for, while, do-while, foreach loops as well as break and continue statements. It provides examples of using each loop type to iterate through arrays and print output. Key looping constructs covered are for loops to iterate a set number of times, while loops to execute code while a condition remains true, do-while loops which execute code once then check the condition, and foreach loops used specifically to iterate over arrays.
PHP Basics
PHP BasicsMuthuganesh S PHP Basics
This document provides an overview of PHP basics including comments, constants, data types, variables, output functions, superglobals, here documents, operators, and references. It discusses the syntax and usage of PHP comments, defines constants, lists the main data types, explains how to declare variables, compares print and echo output functions, outlines common superglobal variables, demonstrates here documents, and covers unary, arithmetic, assignment, comparison, logical, and ternary operators as well as references.
Php
PhpMuthuganesh S This document provides an introduction and overview of PHP, a popular scripting language for web development. PHP is open source, supports many databases, is platform independent, and compatible with servers. It also includes built-in security features and tools to protect web applications. The document explains how to set up either XAMPP or WampServer, start the Apache server, and write a simple PHP script to output text to a web browser.
Introduction to c
Introduction to cMuthuganesh S This document provides an introduction to the C programming language. It discusses that C was created in the 1970s and is a general-purpose, efficient and portable language well-suited for systems and applications programming. The basic elements of C include constants, identifiers, operators, and keywords. It also describes the fundamental data types like int, float, char, and derived types. Various operators in C and their precedence are explained. Finally, it gives a simple "Hello World" example of a C program.
Javascript dom
Javascript domMuthuganesh S This document provides an overview of JavaScript DOM (Document Object Model) and various JavaScript objects used to manipulate web pages and interact with browsers. It describes the DOM hierarchy with the window and document objects at the top. It also covers built-in JavaScript objects like String, Math, Date, forms, and cookies as well as how to define custom user objects. Methods and properties of different objects are defined throughout.
Ad
Recently uploaded (20)
Active Surveillance For Localized Prostate Cancer A New Paradigm For Clinical...
Active Surveillance For Localized Prostate Cancer A New Paradigm For Clinical...wygalkelceqg Active Surveillance For Localized Prostate Cancer A New Paradigm For Clinical Management 2nd Ed Klotz
Active Surveillance For Localized Prostate Cancer A New Paradigm For Clinical Management 2nd Ed Klotz
Active Surveillance For Localized Prostate Cancer A New Paradigm For Clinical Management 2nd Ed Klotz
"Hymenoptera: A Diverse and Fascinating Order".pptx
"Hymenoptera: A Diverse and Fascinating Order".pptxArshad Shaikh Hymenoptera is a diverse order of insects that includes bees, wasps, ants, and sawflies. Characterized by their narrow waists and often social behavior, Hymenoptera play crucial roles in ecosystems as pollinators, predators, and decomposers, with many species exhibiting complex social structures and communication systems.
"Dictyoptera: The Order of Cockroaches and Mantises" Or, more specifically: ...
"Dictyoptera: The Order of Cockroaches and Mantises" Or, more specifically: ...Arshad Shaikh Dictyoptera is an order of insects that includes cockroaches and praying mantises. These insects are characterized by their flat, oval-shaped bodies and unique features such as modified forelegs in mantises for predation. They inhabit diverse environments worldwide.
LDMMIA Bonus GUEST GRAD Student Check-in
LDMMIA Bonus GUEST GRAD Student Check-inLDM & Mia eStudios Happy Summer Everyone. This is also timeless for future viewing.
You all have been upgraded from ‘Guest’ Students to ‘Graduate’ Students. Do Welcome Back. For new guests, please see our free weekly workshops from Spring ‘25’
Blessings, Love, and Namaste’.
Do Welcome to Summer ‘25’ for LDMMIA.
TY, for surviving our First Season/Term of our Reiki Yoga Workshops. These presentations/workshop are designed for your energy wellness.
Also, professional expansion for Summer ‘25’. All updates will be uploaded here and digital notes within our Merch Shop. (I am Completely, using the suggestions of AI for my Biz style. Its spooky accurate. So far, AI has been very helpful for office and studio admin. I even updated my AI avatars. Similar to my SL Meta avatar.)
Do take Care of yourselves. This is only a Bonus Checkin. The Next Workshop will be Lecture/Session 8. I will complete by Friday.
https://ldm-mia.creator-spring.com/
0b - THE ROMANTIC ERA: FEELINGS AND IDENTITY.pptx
0b - THE ROMANTIC ERA: FEELINGS AND IDENTITY.pptxJulián Jesús Pérez Fernández Powerpoint introductorio en inglés sobre el Romanticismo.
PHYSIOLOGY & SPORTS INJURY by Diwakar Sir
PHYSIOLOGY & SPORTS INJURY by Diwakar SirDiwakar Kashyap Diwakar Kashyap
M.P.Ed., M.A.Yoga, Ph.D.(Pursuing)
Athletics & Yoga Coach
Department of Physical Education & Sports
Gurukula Kangri (Deemed to be University)
Haridwar, Uttarakhand, India 249404
Mob. - +919808828367
How to Create Time Off Request in Odoo 18 Time Off
How to Create Time Off Request in Odoo 18 Time OffCeline George Odoo 18 provides an efficient way to manage employee leave through the Time Off module. Employees can easily submit requests, and managers can approve or reject them based on company policies.
Order Lepidoptera: Butterflies and Moths.pptx
Order Lepidoptera: Butterflies and Moths.pptxArshad Shaikh Lepidoptera is an order of insects comprising butterflies and moths. Characterized by scaly wings and a distinct life cycle, Lepidoptera undergo metamorphosis from egg to larva (caterpillar) to pupa (chrysalis or cocoon) and finally to adult. With over 180,000 described species, they exhibit incredible diversity in form, behavior, and habitat, playing vital roles in ecosystems as pollinators, herbivores, and prey. Their striking colors, patterns, and adaptations make them a fascinating group for study and appreciation.
LDMMIA About me 2025 Edition 3 College Volume
LDMMIA About me 2025 Edition 3 College VolumeLDM & Mia eStudios Updated About Me. Used for former college assignments.
Make sure to catch our weekly updates. Updates are done Thursday to Fridays or its a holiday/event weekend.
Thanks again, Readers, Guest Students, and Loyalz/teams.
This profile is older. I started at the beginning of my HQ journey online. It was recommended by AI. AI was very selective but fits my ecourse style. I am media flexible depending on the course platform. More information below.
AI Overview:
“LDMMIA Reiki Yoga refers to a specific program of free online workshops focused on integrating Reiki energy healing techniques with yoga practices. These workshops are led by Leslie M. Moore, also known as LDMMIA, and are designed for all levels, from beginners to those seeking to review their practice. The sessions explore various themes like "Matrix," "Alice in Wonderland," and "Goddess," focusing on self-discovery, inner healing, and shifting personal realities.”
Writing Research Papers: Guidance for Research Community
Writing Research Papers: Guidance for Research CommunityRishi Bankim Chandra Evening College, Naihati, North 24 Parganas, West Bengal, India This study describe how to write the Research Paper and its related issues. It also presents the major sections of Research Paper and various tools & techniques used for Polishing Research Paper
before final submission.
Finding a Right Journal and Publication Ethics are explain in brief.
Pragya Champion's Chalice 2025 Set , General Quiz
Pragya Champion's Chalice 2025 Set , General QuizPragya - UEM Kolkata Quiz Club Pragya Champion's Chalice is the annual Intra Pragya General Quiz hosted by the club's outgoing President and Vice President. The prelims and finals are both given in the singular set.
Dashboard Overview in Odoo 18 - Odoo Slides
Dashboard Overview in Odoo 18 - Odoo SlidesCeline George Odoo 18 introduces significant enhancements to its dashboard functionalities, offering users a more intuitive and customizable experience. The updated dashboards provide real-time insights into various business operations, enabling informed decision-making.
প্রত্যুৎপন্নমতিত্ব - Prottutponnomotittwa 2025.pdf
প্রত্যুৎপন্নমতিত্ব - Prottutponnomotittwa 2025.pdfPragya - UEM Kolkata Quiz Club
Prottutponnomotittwa: A Quiz That Echoed the Pulse of Bengal
On the 31st of May, 2025, PRAGYA – The Official Quiz Club of UEM Kolkata – did not merely organize another quiz. It hosted an ode to Bengal — its people, its quirks, its politics, its art, its rebellion, its heritage. Titled Prottutponnomotittwa, the quiz stood as a metaphor for what Bengal truly is: sharp, intuitive, spontaneous, reflective. A cultural cosmos that thrives on instinct, memory, and emotion.
From the very first slide, it became clear — this wasn’t a quiz made to showcase difficulty or elitism. It was crafted with love — love for Bangla, for its past, present, and its ever-persistent contradictions.
The diversity of the answer list tells the real story of the quiz. The curation was not random. Each answer was a string on a veena of cultural resonance.
In the “Cultural Pairings” round, Anusheh Anadil and Arnob were placed not just as musicians, but as voices of a modern, cross-border Bangla. Their works, which blend baul, jazz, and urban folk, show how Bengal exists simultaneously in Dhaka and Shantiniketan.
The inclusion of Ritwik Chakraborty and Srijit Mukherjee (as a songwriter) showed how the quiz masters understood evolution. Bangla cinema isn’t frozen in the Ray-Ghatak past. It lives, argues, breaks molds — just like these men do.
From Kalyani Black Label to Radhunipagol Chal, consumer culture too had its place. One is liquid courage, the other culinary madness — both deeply Bengali.
The heart truly swelled when the answers touched upon Baidyanath Bhattacharya and Chandril. Both satirists, both sharp, both essential. It was not just about naming them — it was about understanding what different types of literature means in a Bengali context.
Titumir — the play about a peasant rebel who built his own bamboo fort and dared to challenge the British.
Krishnananda Agamvagisha — the mystical Tantric who shaped how we understand esoteric Bengali spiritualism.
Subhas Chandra Bose — the eternal enigma, the braveheart whose shadow looms large over Bengal’s political psyche.
Probashe Ghorkonna — a story lived by many Bengalis. The medinipur daughter, who made a wholesome family, not only in bengal, but across the borders. This answer wasn’t just information. It was emotion.
By the end, what lingered was not the scoreboard. It was a feeling.
The feeling of sitting in a room where Chalchitro meets Chabiwala, where Jamai Shosthi shares the stage with Gayatri Spivak, where Bhupen Hazarika sings with Hemanga Biswas, and where Alimuddin Road and Webskitters occupy the same mental map.
You don’t just remember questions from this quiz.
You remember how it made you feel.
You remember smiling at Keet Keet, nodding at Prabuddha Dasgupta, getting goosebumps at the mention of Bose, and tearing up quietly when someone got Radhunipagol Chal right.
This wasn’t a quiz.
This was an emotional ride of Bangaliyana.
This was — and will remain — Prottutponnomotittwa.
How to Manage Orders in Odoo 18 Lunch - Odoo Slides
How to Manage Orders in Odoo 18 Lunch - Odoo SlidesCeline George The Lunch module in Odoo 18 helps users place their food orders, making meal management seamless and efficient. It allows employees to browse available options, place orders, and track their meals effortlessly.
How to Create a Stage or a Pipeline in Odoo 18 CRM
How to Create a Stage or a Pipeline in Odoo 18 CRMCeline George In Odoo, the CRM (Customer Relationship Management) module’s pipeline is a visual representation of a company's sales process that helps sales teams track and manage their interactions with potential customers.
TechSoup Microsoft Copilot Nonprofit Use Cases and Live Demo - 2025.05.28.pdf
TechSoup Microsoft Copilot Nonprofit Use Cases and Live Demo - 2025.05.28.pdfTechSoup In this webinar we will dive into the essentials of generative AI, address key AI concerns, and demonstrate how nonprofits can benefit from using Microsoft’s AI assistant, Copilot, to achieve their goals.
This event series to help nonprofits obtain Copilot skills is made possible by generous support from Microsoft.
Swachata Quiz - Prelims - 01.10.24 - Quiz Club IIT Patna
Swachata Quiz - Prelims - 01.10.24 - Quiz Club IIT PatnaQuiz Club, Indian Institute of Technology, Patna The Swachata Quiz was conducted by Quiz Club IIT Patna on 1st October 2024. It had questions froma wide array of topics.
THE CHURCH AND ITS IMPACT: FOSTERING CHRISTIAN EDUCATION
THE CHURCH AND ITS IMPACT: FOSTERING CHRISTIAN EDUCATIONPROF. PAUL ALLIEU KAMARA Christian education is an important element in forming moral values, ethical Behaviour and
promoting social unity, especially in diverse nations like in the Caribbean. This study examined
the impact of Christian education on the moral growth in the Caribbean, characterized by
significant Christian denomination, like the Orthodox, Catholic, Methodist, Lutheran and
Pentecostal. Acknowledging the historical and social intricacies in the Caribbean, this study
tends to understand the way in which Christian education mold ethical decision making, influence interpersonal relationships and promote communal values. These studies’ uses, qualitative and quantitative research method to conduct semi-structured interviews for twenty
(25) Church respondents which cut across different age groups and genders in the Caribbean. A
thematic analysis was utilized to identify recurring themes related to ethical Behaviour, communal values and moral development. The study analyses the three objectives of the study:
how Christian education Mold’s ethical Behaviour and enhance communal values, the role of
Christian educating in promoting ecumenism and the effect of Christian education on moral
development. Moreover, the findings show that Christian education serves as a fundamental role
for personal moral evaluation, instilling a well-structured moral value, promoting good
Behaviour and communal responsibility such as integrity, compassion, love and respect. However, the study also highlighted challenges including biases in Christian teachings, exclusivity and misconceptions about certain practices, which impede the actualization of
Writing Research Papers: Guidance for Research Community
Writing Research Papers: Guidance for Research CommunityRishi Bankim Chandra Evening College, Naihati, North 24 Parganas, West Bengal, India
Swachata Quiz - Prelims - 01.10.24 - Quiz Club IIT Patna
Swachata Quiz - Prelims - 01.10.24 - Quiz Club IIT PatnaQuiz Club, Indian Institute of Technology, Patna
Input output statement in C
- 1. Input output statement C S.Muthuganesh M.Sc.,B.Ed
- 2. scanf • Usually input statement is used in C is scanf() Syntax • scanf (“control string”, &v1,&v2,&v3,…&vn); • The control string must be a text enclosed in double quotes. • It contains the data format of data being received. • The ampersand & before each variable is an operator that specified the variable’s names address and connecting it into internal representation in memory. • Example for control string : integer (%d) , float (%f) , character (%c) or string (%s).
- 3. Printf() •printf() function is used to print the “character, string, float, integer, octal and hexadecimal values” onto the output screen. •We use printf() function with %d , %f, %s forrmat specifier to display the value of an variable. •To generate a newline,we use “n” in printf() statement. Syntax printf (“outputstring identifiers(like %s,%d)”, variablenames); Example • printf(“hai hello%s”,name);
- 4. getchar() • getchar is a function in C programming language that reads a single character. getchar() function is used to get/read a character from keyboard input. When this statement encountered the computer waits until key is pressed. Syntax Variable_name=getchar(); • Example char name; name = getchar();
- 5. putchar() • putchar() function in C programming language which is used to write a character on standard output/screen. Syntax putchar(variablename); • Example Choice=’y’; putchar(Choice);
- 6. Thank you